DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5188 and map-1

DIOPT Version :9

Sequence 1:NP_609401.2 Gene:CG5188 / 34428 FlyBaseID:FBgn0032247 Length:317 Species:Drosophila melanogaster
Sequence 2:NP_500396.2 Gene:map-1 / 177128 WormBaseID:WBGene00003129 Length:371 Species:Caenorhabditis elegans


Alignment Length:286 Identity:122/286 - (42%)
Similarity:171/286 - (59%) Gaps:12/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 GQVSPERFVPEEIKKPAYYFKNMPPGNTLGSPEIKSQVQI--------DAMRLSGRLAARILREC 96
            |:|:..|.||:.|.:|.|...  |.|.:|...:.||:..|        :.::::.:|....|.|.
 Worm    72 GRVTDRRPVPDHIPRPDYALH--PQGVSLEERQSKSERVIKVLTDEEKEGLKVACKLGRECLNEA 134

  Fly    97 GKLATVGTTTDQIDAFAHERILESKAYPSPLRYAGFPKSICTSINNIACHGIPDDRQLADGDIIN 161
            .|....|.||::||...||..:|...|||||.|..||||.|||:|.:.||||||.|:|.:||:.|
 Worm   135 AKACGPGVTTEEIDRVVHEAAIERDCYPSPLGYYKFPKSCCTSVNEVICHGIPDMRKLENGDLCN 199

  Fly   162 IDVTVFLNGYHGDCSETFRVGN-VDERGGFLVEATKSCLDQCISLCGPGVEFNEIGKFIDRYCDE 225
            :||||:..|:|||.:|||.||: |||....||:.|..||.|.|::..|||:|.|||..|.::.:.
 Worm   200 VDVTVYHRGFHGDLNETFLVGDKVDEESRKLVKVTFECLQQAIAIVKPGVKFREIGNVIQKHANA 264

  Fly   226 HDLASIAAFIGHGIGSYFHGPPEILHY-YNEIPGKMQPGMTFTIEPILSLGGAEIAVLQDGWTAI 289
            :..:.:..:.||||...||..|.:.|| .|...|.|:.|.:|||||:::.|........|.|||:
 Worm   265 NGFSVVKGYCGHGIHRLFHTAPNVPHYAKNNATGVMKAGNSFTIEPMINAGTYHDDKWPDDWTAV 329

  Fly   290 SLDGARSAQFEHTILITETGTEILTR 315
            :.||.||||||.|:|:|:||.||||:
 Worm   330 TRDGRRSAQFEQTLLVTDTGCEILTK 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5188NP_609401.2 MetAP1 79..315 CDD:238519 108/245 (44%)
map-1NP_500396.2 PLN03158 9..356 CDD:215607 122/286 (43%)
zf-C6H2 11..50 CDD:292429
MetAP1 118..355 CDD:238519 107/236 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1002357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100342
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.