DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5188 and metap1d

DIOPT Version :9

Sequence 1:NP_609401.2 Gene:CG5188 / 34428 FlyBaseID:FBgn0032247 Length:317 Species:Drosophila melanogaster
Sequence 2:XP_017953030.2 Gene:metap1d / 100496112 XenbaseID:XB-GENE-960806 Length:352 Species:Xenopus tropicalis


Alignment Length:306 Identity:155/306 - (50%)
Similarity:192/306 - (62%) Gaps:21/306 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RQKTTARNLFQFGKVKGDTGKYEQIVSTGQVSPERFVPEEIKKPAYYFKNMPP--GNTLGSPEIK 74
            ||:::|.|                ||..|.|||...||:.|.||.|....:.|  |:.:   |||
 Frog    61 RQRSSAYN----------------IVWPGTVSPAHPVPKHIMKPDYVTTGIVPDWGDYI---EIK 106

  Fly    75 SQVQIDAMRLSGRLAARILRECGKLATVGTTTDQIDAFAHERILESKAYPSPLRYAGFPKSICTS 139
            .:.||..:|.:.:||..||...||...||.||::|||..||.|:...||||||.|.|||||:|||
 Frog   107 DEDQIQGLRQACQLARHILLMAGKSLKVGMTTEEIDALVHENIISCNAYPSPLGYGGFPKSVCTS 171

  Fly   140 INNIACHGIPDDRQLADGDIINIDVTVFLNGYHGDCSETFRVGNVDERGGFLVEATKSCLDQCIS 204
            :||:.||||||.|.|.|||||||||||:..|||||.||||.|||||:.|..|||..:.|.|:.|:
 Frog   172 VNNVVCHGIPDSRALQDGDIINIDVTVYFGGYHGDTSETFLVGNVDKCGRALVEIARRCRDEAIA 236

  Fly   205 LCGPGVEFNEIGKFIDRYCDEHDLASIAAFIGHGIGSYFHGPPEILHYYNEIPGKMQPGMTFTIE 269
            :|.||..|:.||..|.|...|:.|....:|:||||||:|||.|||.|:.|:....|:.||.||||
 Frog   237 VCKPGAPFSAIGNTISRIARENGLQVCPSFVGHGIGSFFHGHPEIWHHANDNDFPMEEGMAFTIE 301

  Fly   270 PILSLGGAEIAVLQDGWTAISLDGARSAQFEHTILITETGTEILTR 315
            ||:..|..|..:|:|.|||:|:|..||||.||||.||..|.||||:
 Frog   302 PIIMEGSPEFKILKDKWTAVSVDNKRSAQCEHTIAITSGGAEILTK 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5188NP_609401.2 MetAP1 79..315 CDD:238519 132/235 (56%)
metap1dXP_017953030.2 MetAP1 111..347 CDD:238519 132/235 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 264 1.000 Domainoid score I1883
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H11987
Inparanoid 1 1.050 294 1.000 Inparanoid score I2711
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1002357at2759
OrthoFinder 1 1.000 - - FOG0005461
OrthoInspector 1 1.000 - - oto104073
Panther 1 1.100 - - LDO PTHR43330
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5504
SonicParanoid 1 1.000 - - X3885
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.