DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KdelR and AT1G75760

DIOPT Version :9

Sequence 1:NP_477296.1 Gene:KdelR / 34427 FlyBaseID:FBgn0267330 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_177704.1 Gene:AT1G75760 / 843909 AraportID:AT1G75760 Length:272 Species:Arabidopsis thaliana


Alignment Length:228 Identity:73/228 - (32%)
Similarity:131/228 - (57%) Gaps:22/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NIFRFAGDLSHVFAIIILLLKIWKTRSCAGISGKSQILFAVVYLTRYLDLFTTYVSLYNSVMKVL 66
            |:| .|.:..|...|.:|:.|:.|.|:|||:|.|||.|.|:....|   |:.::|..:: :..:|
plant    47 NLF-VAAEAVHSLGISVLIYKLTKERTCAGLSLKSQELTALFLAVR---LYCSFVMEFD-IHTLL 106

  Fly    67 FLATSGATVYLMYV---KFKATYDHNHDSFRIEFLLVPCALLSLVIN---HEFTVMEVLWTFSIY 125
            ..||...|::::|:   |.||:|..:.|:|.|.::::||.:||::|:   |...:.::.|.|.:|
plant   107 DSATLVTTLFVIYMIRFKLKASYMDDKDNFAIYYVVIPCVVLSVLIHPSTHHHIINKISWAFCVY 171

  Fly   126 LESVAILPQLFLVSRTGEAESITSHYLFALGSYRALYLLNWVYRYMVE----------SHYDLIA 180
            ||:|::||||.::..|...|..|:||:||||..|.|...:||.:.:..          ..:.::.
plant   172 LEAVSVLPQLRVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDTRGRLLTALGYGFWPIMV 236

  Fly   181 IFAGVVQTVLYCDFFYLYITKVLKGK-KLQLPA 212
            :.:.:|||.:..||.|.|:..::.|: .|:||:
plant   237 LLSEIVQTFILADFCYYYVKSLMGGQLVLRLPS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KdelRNP_477296.1 ER_lumen_recept 28..169 CDD:395652 53/146 (36%)
AT1G75760NP_177704.1 ER_lumen_recept 72..215 CDD:279187 53/146 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5196
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1186269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10585
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.