DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KdelR and Kdelr3

DIOPT Version :9

Sequence 1:NP_477296.1 Gene:KdelR / 34427 FlyBaseID:FBgn0267330 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_001121018.1 Gene:Kdelr3 / 315131 RGDID:1311536 Length:214 Species:Rattus norvegicus


Alignment Length:211 Identity:137/211 - (64%)
Similarity:179/211 - (84%) Gaps:0/211 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNIFRFAGDLSHVFAIIILLLKIWKTRSCAGISGKSQILFAVVYLTRYLDLFTTYVSLYNSVMKV 65
            ||:||..|||||:.|:|:||:|||:::||||||||||||||:|:.|||||||:.::|:||:||||
  Rat     1 MNVFRILGDLSHLLAMILLLVKIWRSKSCAGISGKSQILFALVFTTRYLDLFSNFISIYNTVMKV 65

  Fly    66 LFLATSGATVYLMYVKFKATYDHNHDSFRIEFLLVPCALLSLVINHEFTVMEVLWTFSIYLESVA 130
            :||..:..|||::|.||:.|:|..:|:||:|||:||...||.::|:.:..||:||||||||||||
  Rat    66 VFLLCAYVTVYMIYWKFRKTFDIENDTFRLEFLVVPVTGLSFLVNYSYAPMEILWTFSIYLESVA 130

  Fly   131 ILPQLFLVSRTGEAESITSHYLFALGSYRALYLLNWVYRYMVESHYDLIAIFAGVVQTVLYCDFF 195
            ||||||::|:|||||:||:||||.||.||.|||.||:.||..|:.||.|::.:|||||:.|||||
  Rat   131 ILPQLFMISKTGEAETITTHYLFFLGLYRLLYLANWIRRYQTENFYDQISVVSGVVQTIFYCDFF 195

  Fly   196 YLYITKVLKGKKLQLP 211
            |||:|||||||||.||
  Rat   196 YLYVTKVLKGKKLSLP 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KdelRNP_477296.1 ER_lumen_recept 28..169 CDD:395652 91/140 (65%)
Kdelr3NP_001121018.1 ER_lumen_recept 28..169 CDD:395652 91/140 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340111
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53919
OrthoDB 1 1.010 - - D1186269at2759
OrthoFinder 1 1.000 - - FOG0000906
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101087
Panther 1 1.100 - - O PTHR10585
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X521
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.