DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KdelR and KDELR1

DIOPT Version :9

Sequence 1:NP_477296.1 Gene:KdelR / 34427 FlyBaseID:FBgn0267330 Length:212 Species:Drosophila melanogaster
Sequence 2:NP_006792.1 Gene:KDELR1 / 10945 HGNCID:6304 Length:212 Species:Homo sapiens


Alignment Length:212 Identity:159/212 - (75%)
Similarity:189/212 - (89%) Gaps:0/212 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNIFRFAGDLSHVFAIIILLLKIWKTRSCAGISGKSQILFAVVYLTRYLDLFTTYVSLYNSVMKV 65
            ||:|||.|||||:.|||:|||||||:|||||||||||:|||||:..|||||||.|:||||:.|||
Human     1 MNLFRFLGDLSHLLAIILLLLKIWKSRSCAGISGKSQVLFAVVFTARYLDLFTNYISLYNTCMKV 65

  Fly    66 LFLATSGATVYLMYVKFKATYDHNHDSFRIEFLLVPCALLSLVINHEFTVMEVLWTFSIYLESVA 130
            :::|.|..||:|:|.|||||||.|||:||:|||:||.|:|:.::||:||.:|:||||||||||||
Human    66 VYIACSFTTVWLIYSKFKATYDGNHDTFRVEFLVVPTAILAFLVNHDFTPLEILWTFSIYLESVA 130

  Fly   131 ILPQLFLVSRTGEAESITSHYLFALGSYRALYLLNWVYRYMVESHYDLIAIFAGVVQTVLYCDFF 195
            ||||||:||:|||||:||||||||||.||.|||.||::||..|..:|||||.||:||||||||||
Human   131 ILPQLFMVSKTGEAETITSHYLFALGVYRTLYLFNWIWRYHFEGFFDLIAIVAGLVQTVLYCDFF 195

  Fly   196 YLYITKVLKGKKLQLPA 212
            |||||||||||||.|||
Human   196 YLYITKVLKGKKLSLPA 212

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
KdelRNP_477296.1 ER_lumen_recept 28..169 CDD:395652 102/140 (73%)
KDELR1NP_006792.1 ER_lumen_recept 28..169 CDD:395652 102/140 (73%)