DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KdelR and LOC100537437

DIOPT Version :9

Sequence 1:NP_477296.1 Gene:KdelR / 34427 FlyBaseID:FBgn0267330 Length:212 Species:Drosophila melanogaster
Sequence 2:XP_021327592.1 Gene:LOC100537437 / 100537437 -ID:- Length:185 Species:Danio rerio


Alignment Length:137 Identity:84/137 - (61%)
Similarity:110/137 - (80%) Gaps:0/137 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 VLFLATSGATVYLMYVKFKATYDHNHDSFRIEFLLVPCALLSLVINHEFTVMEVLWTFSIYLESV 129
            |::|..:.:||.|::.:|:.:||...||||:||||||.|.||.:.|:.||.:|:|||||||||||
Zfish    19 VVYLLLAYSTVGLIFFRFRNSYDSESDSFRVEFLLVPVAGLSFLENYAFTPLEILWTFSIYLESV 83

  Fly   130 AILPQLFLVSRTGEAESITSHYLFALGSYRALYLLNWVYRYMVESHYDLIAIFAGVVQTVLYCDF 194
            |||||||::::||||||||:|||..||.||||||.||::|:..|..||.||:.:|||||:.||||
Zfish    84 AILPQLFMITKTGEAESITAHYLLFLGLYRALYLANWLWRFHTEGFYDQIAVVSGVVQTIFYCDF 148

  Fly   195 FYLYITK 201
            ||||.|:
Zfish   149 FYLYFTR 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KdelRNP_477296.1 ER_lumen_recept 28..169 CDD:395652 64/103 (62%)
LOC100537437XP_021327592.1 ER_lumen_recept <19..123 CDD:307105 64/103 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1186269at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.