DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmB and SMB1

DIOPT Version :9

Sequence 1:NP_001188780.1 Gene:SmB / 34426 FlyBaseID:FBgn0262601 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_010946.3 Gene:SMB1 / 856751 SGDID:S000000831 Length:196 Species:Saccharomyces cerevisiae


Alignment Length:228 Identity:57/228 - (25%)
Similarity:86/228 - (37%) Gaps:76/228 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IGKNNKMIQHLNYRVRIVLQDSRTFIGTFKAFDKHMNLILGDCEEFRKIRSKNSKVPERE----- 62
            :..::::...::|::|::.||.|.:||...||||||||:|.:|.|.|..:::..|:..|:     
Yeast     6 VAHSSRLANLIDYKLRVLTQDGRVYIGQLMAFDKHMNLVLNECIEERVPKTQLDKLRPRKDSKDG 70

  Fly    63 -------EKRVLGFVLLRGENIVSLTVEGPP--PPEEGLPR------------------VPIPGA 100
                   ||||||..:||||.|:|..||..|  ..:|.|.|                  ...||.
Yeast    71 TTLNIKVEKRVLGLTILRGEQILSTVVEDKPLLSKKERLVRDKKEKKQAQKQTKLRKEKEKKPGK 135

  Fly   101 APGPGIGRVAGRGMPINLSAVPAGLQGPVRGVGGPAQQHMAPMGRGVPRAPMMGAPPPGMIPGGM 165
            ...|.....                            :|.:...|.:.:      |......||.
Yeast   136 IAKPNTANA----------------------------KHTSSNSREIAQ------PSSSRYNGGN 166

  Fly   166 PSMPGNMGR---GAPPPMRGPPPSMIRGAPPPG 195
            .::..|..|   .|||..|       :..||||
Yeast   167 DNIGANRSRFNNEAPPQTR-------KFQPPPG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmBNP_001188780.1 Sm_B 5..82 CDD:212464 33/88 (38%)
SMB1NP_010946.3 Sm_B 8..98 CDD:212464 33/89 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344174
Domainoid 1 1.000 65 1.000 Domainoid score I2411
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002776
OrthoInspector 1 1.000 - - oto99921
orthoMCL 1 0.900 - - OOG6_101868
Panther 1 1.100 - - LDO PTHR10701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1254
SonicParanoid 1 1.000 - - X2167
TreeFam 00.000 Not matched by this tool.
1110.770

Return to query results.
Submit another query.