DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmB and LSM6

DIOPT Version :9

Sequence 1:NP_001188780.1 Gene:SmB / 34426 FlyBaseID:FBgn0262601 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_010666.2 Gene:LSM6 / 851984 SGDID:S000002786 Length:86 Species:Saccharomyces cerevisiae


Alignment Length:79 Identity:18/79 - (22%)
Similarity:30/79 - (37%) Gaps:16/79 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IGKNNKMIQHLNYRVRIVLQDSRTFIGTFKAFDKHMNLILGDCEEFRKIRSKNSKVPEREEKRVL 67
            |||.          |.:.|.....:.|..::.|..||:.|....|  ...|.|:|:..:....  
Yeast    20 IGKT----------VNVKLASGLLYSGRLESIDGFMNVALSSATE--HYESNNNKLLNKFNSD-- 70

  Fly    68 GFVLLRGENIVSLT 81
              |.|||..::.::
Yeast    71 --VFLRGTQVMYIS 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmBNP_001188780.1 Sm_B 5..82 CDD:212464 16/77 (21%)
LSM6NP_010666.2 Sm_like 14..82 CDD:412267 18/77 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.