DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmB and smB

DIOPT Version :9

Sequence 1:NP_001188780.1 Gene:SmB / 34426 FlyBaseID:FBgn0262601 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001031682.1 Gene:smB / 827792 AraportID:AT4G20440 Length:257 Species:Arabidopsis thaliana


Alignment Length:229 Identity:113/229 - (49%)
Similarity:139/229 - (60%) Gaps:36/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTIGKNNKMIQHLNYRVRIVLQDSRTFIGTFKAFDKHMNLILGDCEEFRKI-RSKNSKV-PEREE 63
            |::.|::||:|.:|||:|:.:||.|..:|.|.|||:||||:|||||||||: .:|..|: .|||:
plant     1 MSMSKSSKMLQFINYRMRVTIQDGRQLVGKFMAFDRHMNLVLGDCEEFRKLPPAKGKKINEERED 65

  Fly    64 KRVLGFVLLRGENIVSLTVEGPPPPEEGLPRVPIPGAAPGPGIGRVAGRGMPIN--LSAVPAGLQ 126
            :|.||.||||||.::|:||||||||||...:.....|..||||||.||||:|..  :.|.| ||.
plant    66 RRTLGLVLLRGEEVISMTVEGPPPPEESRAKAGSAAAVAGPGIGRAAGRGVPTGPLVQAQP-GLS 129

  Fly   127 GPVRGVGGPAQQHMAPMGRGVPRAPMMGAPPPGMIPGGM---PSMPGN---MGRGAPPP--MR-- 181
            ||||||||||...|.|.   :.|.|.:.|||....||.|   |...|.   ||||.|||  ||  
plant   130 GPVRGVGGPAPGMMQPQ---ISRPPQLSAPPIIRPPGQMLPPPPFGGQGPPMGRGPPPPYGMRPP 191

  Fly   182 -----GPPP-------------SMIRGAPPPGRG 197
                 ||||             .|:||.|||..|
plant   192 PQQFSGPPPPQYGQRPMIPPPGGMMRGPPPPPHG 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmBNP_001188780.1 Sm_B 5..82 CDD:212464 44/78 (56%)
smBNP_001031682.1 Sm_B 5..85 CDD:212464 45/79 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I2326
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 198 1.000 Inparanoid score I1326
OMA 1 1.010 - - QHG54849
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002776
OrthoInspector 1 1.000 - - otm2751
orthoMCL 1 0.900 - - OOG6_101868
Panther 1 1.100 - - LDO PTHR10701
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2167
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.