powered by:
Protein Alignment SmB and Snrpd2
DIOPT Version :9
Sequence 1: | NP_001188780.1 |
Gene: | SmB / 34426 |
FlyBaseID: | FBgn0262601 |
Length: | 199 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001102869.1 |
Gene: | Snrpd2 / 680309 |
RGDID: | 1593018 |
Length: | 118 |
Species: | Rattus norvegicus |
Alignment Length: | 70 |
Identity: | 18/70 - (25%) |
Similarity: | 39/70 - (55%) |
Gaps: | 6/70 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 NYRVRIVLQDSRTFIGTFKAFDKHMNLILGDCEEF-----RKIRSKNSKVPEREEKRVLGFVLLR 73
|.:|.|..::::..:|..||||:|.|::|.:.:|. :..:.|....|..:: |.:..:.||
Rat 39 NTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKD-RYISKMFLR 102
Fly 74 GENIV 78
|::::
Rat 103 GDSVI 107
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmB | NP_001188780.1 |
Sm_B |
5..82 |
CDD:212464 |
18/70 (26%) |
Snrpd2 | NP_001102869.1 |
Sm_D2 |
24..113 |
CDD:212467 |
18/70 (26%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.