DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmB and SNRPB

DIOPT Version :9

Sequence 1:NP_001188780.1 Gene:SmB / 34426 FlyBaseID:FBgn0262601 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_937859.1 Gene:SNRPB / 6628 HGNCID:11153 Length:240 Species:Homo sapiens


Alignment Length:235 Identity:137/235 - (58%)
Similarity:157/235 - (66%) Gaps:41/235 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTIGKNNKMIQHLNYRVRIVLQDSRTFIGTFKAFDKHMNLILGDCEEFRKIRSKNSKVPEREEKR 65
            ||:||::||:||::||:|.:|||.|.||||||||||||||||.||:|||||:.||||..||||||
Human     1 MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKR 65

  Fly    66 VLGFVLLRGENIVSLTVEGPPPPEEGLPRVPIPGAAPGPGIGRVAGRGMP--INLSAVPAGLQGP 128
            |||.|||||||:||:|||||||.:.|:.|||:.|||.||||||.||||:|  :.:...||||.||
Human    66 VLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGP 130

  Fly   129 VRGVGGPAQQHMAPMGRGV-------------------------PRAPM-MGAPPPGMI---PGG 164
            |||||||:||.|.|.|||.                         |..|| .|||||||:   ||.
Human   131 VRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGM 195

  Fly   165 MPSMPGNMG--------RGAPPP-MRGPPPSMIRGAPPPG 195
            .|.|...||        .|.||| ||.|||.| ||.||||
Human   196 RPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGM-RGPPPPG 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmBNP_001188780.1 Sm_B 5..82 CDD:212464 57/76 (75%)
SNRPBNP_937859.1 Sm_B 5..83 CDD:212464 58/77 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..240 32/73 (44%)
Repeat-rich region 175..236 32/61 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141598
Domainoid 1 1.000 124 1.000 Domainoid score I5531
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 251 1.000 Inparanoid score I3228
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54849
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002776
OrthoInspector 1 1.000 - - otm41722
orthoMCL 1 0.900 - - OOG6_101868
Panther 1 1.100 - - LDO PTHR10701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1254
SonicParanoid 1 1.000 - - X2167
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.