DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmB and snrpe

DIOPT Version :9

Sequence 1:NP_001188780.1 Gene:SmB / 34426 FlyBaseID:FBgn0262601 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001005147.1 Gene:snrpe / 448738 XenbaseID:XB-GENE-5922245 Length:92 Species:Xenopus tropicalis


Alignment Length:92 Identity:26/92 - (28%)
Similarity:44/92 - (47%) Gaps:24/92 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GKNNK----MIQHLNYRVRIVLQDSRTFI-----------GTFKAFDKHMNLILGDCEEFRKIRS 53
            |:..|    |:|.:|...|.:...||..:           |....||::|||:|.|.||.. :::
 Frog     5 GQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIH-LKT 68

  Fly    54 KNSKVPEREEKRVLGFVLLRGENIVSL 80
            |:        ::.||.::|:|:||..|
 Frog    69 KS--------RKQLGRIMLKGDNITLL 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmBNP_001188780.1 Sm_B 5..82 CDD:212464 25/91 (27%)
snrpeNP_001005147.1 Sm_E 11..89 CDD:212465 24/86 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.