DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmB and naa38

DIOPT Version :9

Sequence 1:NP_001188780.1 Gene:SmB / 34426 FlyBaseID:FBgn0262601 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_001153763.1 Gene:naa38 / 335819 ZFINID:ZDB-GENE-030131-7762 Length:109 Species:Danio rerio


Alignment Length:76 Identity:29/76 - (38%)
Similarity:42/76 - (55%) Gaps:4/76 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KMIQHLNYRVRIVLQDSRTFIGTFKAFDKHMNLILGDCEEFRKIRSKNSKVPEREEKRVLGFVLL 72
            |:...||..:||.:.|.||.:|.|...|:..|:|||..:||.|.....|    :.|.||||..::
Zfish    27 KLENLLNKSMRIRMTDGRTLVGLFLCTDRDCNVILGSAQEFLKSTDSLS----QGEPRVLGLAMI 87

  Fly    73 RGENIVSLTVE 83
            .|.::||:.||
Zfish    88 PGHHVVSIEVE 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmBNP_001188780.1 Sm_B 5..82 CDD:212464 27/73 (37%)
naa38NP_001153763.1 LSMD1 25..98 CDD:212486 27/74 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.