powered by:
Protein Alignment SmB and Lsm2
DIOPT Version :9
Sequence 1: | NP_001188780.1 |
Gene: | SmB / 34426 |
FlyBaseID: | FBgn0262601 |
Length: | 199 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_085100.1 |
Gene: | Lsm2 / 27756 |
MGIID: | 90676 |
Length: | 131 |
Species: | Mus musculus |
Alignment Length: | 42 |
Identity: | 10/42 - (23%) |
Similarity: | 21/42 - (50%) |
Gaps: | 10/42 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 IGKNNKMIQHLNYRVRIVLQDSRTFIGTFKAFDKHMNLILGD 44
:||: |.:.|::..:..||..:.|:::|:.|.|
Mouse 47 VGKD----------VVVELKNDLSICGTLHSVDQYLNIKLTD 78
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmB | NP_001188780.1 |
Sm_B |
5..82 |
CDD:212464 |
9/40 (23%) |
Lsm2 | NP_085100.1 |
LSm2 |
38..126 |
CDD:212472 |
10/42 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.