DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmB and smb1

DIOPT Version :9

Sequence 1:NP_001188780.1 Gene:SmB / 34426 FlyBaseID:FBgn0262601 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_594151.1 Gene:smb1 / 2542684 PomBaseID:SPAC26A3.08 Length:147 Species:Schizosaccharomyces pombe


Alignment Length:175 Identity:76/175 - (43%)
Similarity:95/175 - (54%) Gaps:40/175 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KMIQHLNYRVRIVLQDSRTFIGTFKAFDKHMNLILGDCEEFRKIRSKNSKVPER---EEKRVLGF 69
            ||:..||:.:.:..:|.|||:|...|||..|||:|.||:|:|.|:.:|  ||..   ||||:||.
pombe     5 KMVSLLNHSLNVTTKDGRTFVGQLLAFDGFMNLVLSDCQEYRHIKKQN--VPSNSVYEEKRMLGL 67

  Fly    70 VLLRGENIVSLTVEGPPPPEEGLPRVPIPGAAPGPGIGRVAGRGMPINLSAVPAGLQGPVRGVGG 134
            |:||||.||||:|:||||.:..:.    .....|||:.|.||||:|  |...|.||.||||||| 
pombe    68 VILRGEFIVSLSVQGPPPMDPSMR----GSLLSGPGVARPAGRGIP--LGQAPVGLAGPVRGVG- 125

  Fly   135 PAQQHMAPMGRGVPRAPMMGAPPPGMIPGGMPSMPGNMGRGAPPP 179
                              ..||||          |...|||||||
pombe   126 ------------------YTAPPP----------PAGFGRGAPPP 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmBNP_001188780.1 Sm_B 5..82 CDD:212464 39/76 (51%)
smb1NP_594151.1 Sm_B 2..81 CDD:212464 39/77 (51%)
Bindin 82..>147 CDD:251078 36/96 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 74 1.000 Domainoid score I2522
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 129 1.000 Inparanoid score I1434
OMA 1 1.010 - - QHG54849
OrthoFinder 1 1.000 - - FOG0002776
OrthoInspector 1 1.000 - - oto101626
orthoMCL 1 0.900 - - OOG6_101868
Panther 1 1.100 - - LDO PTHR10701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1254
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.