DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmB and LSM5

DIOPT Version :9

Sequence 1:NP_001188780.1 Gene:SmB / 34426 FlyBaseID:FBgn0262601 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_036454.1 Gene:LSM5 / 23658 HGNCID:17162 Length:91 Species:Homo sapiens


Alignment Length:72 Identity:23/72 - (31%)
Similarity:32/72 - (44%) Gaps:7/72 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RVRIVLQDSRTFIGTFKAFDKHMNLILGDCEEFRKIRSKNSKVPEREEKRVLGFVLLRGENIVSL 80
            |:.||::..:..:||...||..:|::|.|..||       ...||......|..:||.|.||..|
Human    25 RIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEF-------EITPEGRRITKLDQILLNGNNITML 82

  Fly    81 TVEGPPP 87
            ...|..|
Human    83 VPGGEGP 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmBNP_001188780.1 Sm_B 5..82 CDD:212464 21/65 (32%)
LSM5NP_036454.1 LSm5 11..86 CDD:212479 21/67 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.