DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmB and Snrpb

DIOPT Version :9

Sequence 1:NP_001188780.1 Gene:SmB / 34426 FlyBaseID:FBgn0262601 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_033251.1 Gene:Snrpb / 20638 MGIID:98342 Length:231 Species:Mus musculus


Alignment Length:215 Identity:136/215 - (63%)
Similarity:156/215 - (72%) Gaps:23/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTIGKNNKMIQHLNYRVRIVLQDSRTFIGTFKAFDKHMNLILGDCEEFRKIRSKNSKVPEREEKR 65
            ||:||::||:||::||:|.:|||.|.||||||||||||||||.||:|||||:.||||..||||||
Mouse     1 MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKR 65

  Fly    66 VLGFVLLRGENIVSLTVEGPPPPEEGLPRVPIPGAAPGPGIGRVAGRGMP--INLSAVPAGLQGP 128
            |||.|||||||:||:|||||||.:.|:.|||:.|||.||||||.||||:|  :.:...||||.||
Mouse    66 VLGLVLLRGENLVSMTVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGP 130

  Fly   129 VRGVGGPAQQHMAPMGRG-------VPRAPMMGAP---PPGMIPGGMPSMPGNMGRGAPPP-MRG 182
            |||||||:||.|.|.|||       ...|.:.|||   |||.  ||.|.   .|||||||| |.|
Mouse   131 VRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGR--GGPPP---PMGRGAPPPGMMG 190

  Fly   183 PPPSM--IRGAP---PPGRG 197
            |||.|  ..|.|   |||||
Mouse   191 PPPGMRPPMGPPMGLPPGRG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmBNP_001188780.1 Sm_B 5..82 CDD:212464 57/76 (75%)
SnrpbNP_033251.1 Sm_B 5..83 CDD:212464 58/77 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..231 30/53 (57%)
Repeat-rich region 175..228 22/39 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831547
Domainoid 1 1.000 124 1.000 Domainoid score I5497
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 251 1.000 Inparanoid score I3202
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54849
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002776
OrthoInspector 1 1.000 - - otm43772
orthoMCL 1 0.900 - - OOG6_101868
Panther 1 1.100 - - LDO PTHR10701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1254
SonicParanoid 1 1.000 - - X2167
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.