DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmB and snr-1

DIOPT Version :9

Sequence 1:NP_001188780.1 Gene:SmB / 34426 FlyBaseID:FBgn0262601 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_503027.1 Gene:snr-1 / 178483 WormBaseID:WBGene00004914 Length:136 Species:Caenorhabditis elegans


Alignment Length:148 Identity:39/148 - (26%)
Similarity:51/148 - (34%) Gaps:48/148 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GTFKAFDKHMNLILGD-CEEFRKIRSKNSKVPEREEKRVLGFVLLRGENIVSLTVEGPPPPEEGL 92
            |.....:.:||..|.: ...||..||..           |..|.:||..|..:.:   |...:..
 Worm    31 GKLSEAEDNMNCQLAETVVTFRDGRSHQ-----------LDNVFIRGNKIRFMIL---PDMLKNA 81

  Fly    93 PRVPIPGAAP----GPGIGRVAGRGMPINLSAVPAGLQGPVRGVGGPAQQHMAPMGRGVPRAPMM 153
            |.....|.|.    |.|:|.:..||                ||.|...::   |||||.||    
 Worm    82 PMFKNIGRAQKGAIGMGLGGLDQRG----------------RGRGTAFRR---PMGRGGPR---- 123

  Fly   154 GAPPPGMI-PGGMPSMPG 170
                 ||. |||.|:..|
 Worm   124 -----GMSRPGGAPTFRG 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmBNP_001188780.1 Sm_B 5..82 CDD:212464 13/53 (25%)
snr-1NP_503027.1 Sm_D3 7..76 CDD:212468 13/58 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.