DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmB and snr-2

DIOPT Version :9

Sequence 1:NP_001188780.1 Gene:SmB / 34426 FlyBaseID:FBgn0262601 Length:199 Species:Drosophila melanogaster
Sequence 2:NP_493348.1 Gene:snr-2 / 173204 WormBaseID:WBGene00004915 Length:160 Species:Caenorhabditis elegans


Alignment Length:173 Identity:87/173 - (50%)
Similarity:108/173 - (62%) Gaps:21/173 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTIGKNNKMIQHLNYRVRIVLQDSRTFIGTFKAFDKHMNLILGDCEEFRKIRSKNSKVPEREEKR 65
            |||.|||||:.|||||::|:|||.|||||.|||||||||::|.:|||.|:|:.|..|..:.||||
 Worm     1 MTISKNNKMMAHLNYRMKIILQDGRTFIGFFKAFDKHMNILLAECEEHRQIKPKAGKKTDGEEKR 65

  Fly    66 VLGFVLLRGENIVSLTVEGPPPPEEGLPRVPIPGAAPGPGIGRVAGRGMP-------INLSAVPA 123
            :||.||:|||:|||:||:||||.::...|:...|.|.|.|..:..|||||       :.....|.
 Worm    66 ILGLVLVRGEHIVSMTVDGPPPRDDDSVRLAKAGGAGGVGQAKPGGRGMPAMPGMPGMPPGGAPG 130

  Fly   124 GLQGPVRGVGGPAQQHMAPMGRGVPRAPMMGAPPPGMIPGGMP 166
            ||.|.:||.|||....|.| |.|.|             |||.|
 Worm   131 GLSGAMRGHGGPGMAAMQP-GYGGP-------------PGGRP 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmBNP_001188780.1 Sm_B 5..82 CDD:212464 50/76 (66%)
snr-2NP_493348.1 Sm_B 5..83 CDD:212464 51/77 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160070
Domainoid 1 1.000 104 1.000 Domainoid score I4228
eggNOG 1 0.900 - - E1_COG1958
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H68297
Inparanoid 1 1.050 161 1.000 Inparanoid score I2861
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54849
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002776
OrthoInspector 1 1.000 - - oto20509
orthoMCL 1 0.900 - - OOG6_101868
Panther 1 1.100 - - LDO PTHR10701
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1254
SonicParanoid 1 1.000 - - X2167
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.830

Return to query results.
Submit another query.