powered by:
Protein Alignment SmB and LSM6
DIOPT Version :9
Sequence 1: | NP_001188780.1 |
Gene: | SmB / 34426 |
FlyBaseID: | FBgn0262601 |
Length: | 199 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_009011.1 |
Gene: | LSM6 / 11157 |
HGNCID: | 17017 |
Length: | 80 |
Species: | Homo sapiens |
Alignment Length: | 67 |
Identity: | 15/67 - (22%) |
Similarity: | 27/67 - (40%) |
Gaps: | 10/67 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 VRIVLQDSRTFIGTFKAFDKHMNLILGDCEEFRKIRSKNSKVPEREEKRVLGFVLLRGENIVSLT 81
|.:.|.....:.|.....|.:||:.|...||:...:.||. .|...:||.|::.::
Human 20 VVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNK----------YGDAFIRGNNVLYIS 74
Fly 82 VE 83
.:
Human 75 TQ 76
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
SmB | NP_001188780.1 |
Sm_B |
5..82 |
CDD:212464 |
15/64 (23%) |
LSM6 | NP_009011.1 |
LSm6 |
7..74 |
CDD:212473 |
15/63 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG1958 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.