DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and AT5G49200

DIOPT Version :9

Sequence 1:NP_001188779.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_199731.1 Gene:AT5G49200 / 834979 AraportID:AT5G49200 Length:419 Species:Arabidopsis thaliana


Alignment Length:259 Identity:59/259 - (22%)
Similarity:101/259 - (38%) Gaps:63/259 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LLSKLEGSSDDVNAAILIPGENGVISVSDDKTVRVWLKRDSGQYWPSICQYMPSGCTAIEYVSES 88
            :::.|||.:.::....|..|.:.:.|||.|.|:||| ..:|||...||.....:|    ..:||.
plant   123 MVASLEGHNKELKGIALPEGSDKLFSVSIDGTLRVW-DCNSGQCVHSINLDAEAG----SLISEG 182

  Fly    89 RHLYVGQENG-TVTQYALSEDCNRLSFLRDYLSHQARVMAVVFSKTHKWILSAGKDKQFAYHCTE 152
            ..:::|..|. .......|:|                                       .|...
plant   183 PWVFLGLPNAIKAFNVQTSQD---------------------------------------LHLQA 208

  Fly   153 SGKRVGGYNFETPCTALQFDALAKYAFVGDHAGQITMLRCDVQG----VQLITTFNGHSAEIRCL 213
            :|. ||..|..|....:        .|.|..:|.|.:.:.....    .:.:|:..|||.|:.| 
plant   209 AGV-VGQVNAMTIANGM--------LFAGTSSGSILVWKATTDSESDPFKYLTSLEGHSGEVTC- 263

  Fly   214 KWVEGPQLLFSGACDQSVLVWDVGGKRGTIYELQGHSNKVSALSYANHTQQLISCGEDSVVVFW 277
             :..|.|:|:||:.|:::.:||:...: .|..|:.|:..|::|...:  :.|||...|..:..|
plant   264 -FAVGGQMLYSGSVDKTIKMWDLNTLQ-CIMTLKQHTGTVTSLLCWD--KCLISSSLDGTIKVW 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_001188779.1 WD40 4..405 CDD:225201 59/259 (23%)
WD40 24..279 CDD:295369 59/259 (23%)
WD40 repeat 35..72 CDD:293791 14/36 (39%)
WD40 repeat 80..117 CDD:293791 6/37 (16%)
WD40 repeat 125..161 CDD:293791 4/35 (11%)
WD40 repeat 166..205 CDD:293791 5/42 (12%)
WD40 repeat 211..248 CDD:293791 11/36 (31%)
WD40 repeat 253..283 CDD:293791 7/25 (28%)
FYVE_WDFY1_like 287..356 CDD:277258
WD40 repeat 324..371 CDD:293791
AT5G49200NP_199731.1 ZnF_C3H1 94..114 CDD:214632
WD40 123..411 CDD:421866 59/259 (23%)
WD40 repeat 177..256 CDD:293791 17/126 (13%)
WD40 repeat 261..295 CDD:293791 10/36 (28%)
WD40 repeat 302..337 CDD:293791 6/24 (25%)
WD40 repeat 344..384 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.