DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Wdfy2 and STAM

DIOPT Version :9

Sequence 1:	NP_001188779.1	Gene:	Wdfy2 / 34425	FlyBaseID:	FBgn0032246	Length:	408	Species:	Drosophila melanogaster
Sequence 2:	NP_003464.1	Gene:	STAM / 8027	HGNCID:	11357	Length:	540	Species:	Homo sapiens

Alignment Length:	68	Identity:	15/68 - (22%)
Similarity:	30/68 - (44%)	Gaps:	8/68 - (11%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 PAQRTNNDRFNTSKKPELLSKLEGSSDDVNAAILIPGENGVISVSDDKTVRVWLKRDSGQYWPSI 71
            |:|:|.....||     ::|.::|::....|.:..|......:.:   |..|.|.:::|...|.:
Human   452 PSQQTQAAYPNT-----MVSSVQGNTYPSQAPVYSPPPAATAAAA---TADVTLYQNAGPNMPQV 508

  Fly    72 CQY 74
            ..|
Human   509 PNY 511

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Wdfy2	NP_001188779.1	WD40	4..405	CDD:225201	15/68 (22%)
		WD40	24..279	CDD:295369	10/51 (20%)
		WD40 repeat	35..72	CDD:293791	7/36 (19%)
		WD40 repeat	80..117	CDD:293791
		WD40 repeat	125..161	CDD:293791
		WD40 repeat	166..205	CDD:293791
		WD40 repeat	211..248	CDD:293791
		WD40 repeat	253..283	CDD:293791
		FYVE_WDFY1_like	287..356	CDD:277258
		WD40 repeat	324..371	CDD:293791
STAM	NP_003464.1	VHS_STAM	9..142	CDD:239625
		SH3_STAM1	213..267	CDD:212897
		GAT	306..377	CDD:281166
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	500..540		3/12 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165141213
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930