DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and fbxa-169

DIOPT Version :9

Sequence 1:NP_001188779.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001364654.1 Gene:fbxa-169 / 6418621 WormBaseID:WBGene00045289 Length:302 Species:Caenorhabditis elegans


Alignment Length:34 Identity:11/34 - (32%)
Similarity:17/34 - (50%) Gaps:2/34 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 FEFDVRTCDPCYKQLQTVERPSLAS--FNDAKHS 376
            |:..::..|...|.|..:||.:|.:  ||..|.|
 Worm    75 FDLPLQIHDKILKNLNVLERLNLRNVCFNFRKIS 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_001188779.1 WD40 4..405 CDD:225201 11/34 (32%)
WD40 24..279 CDD:295369
WD40 repeat 35..72 CDD:293791
WD40 repeat 80..117 CDD:293791
WD40 repeat 125..161 CDD:293791
WD40 repeat 166..205 CDD:293791
WD40 repeat 211..248 CDD:293791
WD40 repeat 253..283 CDD:293791
FYVE_WDFY1_like 287..356 CDD:277258 2/10 (20%)
WD40 repeat 324..371 CDD:293791 7/27 (26%)
fbxa-169NP_001364654.1 HTH_48 9..58 CDD:407758
FBOX 77..110 CDD:197608 10/32 (31%)
FTH 207..>301 CDD:396410
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1409
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.