DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and fbxa-169

DIOPT Version :10

Sequence 1:NP_609400.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001364654.1 Gene:fbxa-169 / 6418621 WormBaseID:WBGene00045289 Length:302 Species:Caenorhabditis elegans


Alignment Length:34 Identity:11/34 - (32%)
Similarity:17/34 - (50%) Gaps:2/34 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 FEFDVRTCDPCYKQLQTVERPSLAS--FNDAKHS 376
            |:..::..|...|.|..:||.:|.:  ||..|.|
 Worm    75 FDLPLQIHDKILKNLNVLERLNLRNVCFNFRKIS 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_609400.1 WD40 24..279 CDD:475233
WD40 repeat 35..72 CDD:293791
WD40 repeat 80..117 CDD:293791
WD40 repeat 125..161 CDD:293791
WD40 repeat 166..205 CDD:293791
WD40 repeat 211..248 CDD:293791
WD40 repeat 253..283 CDD:293791
FYVE_WDFY1_like 287..356 CDD:277258 2/10 (20%)
WD40 repeat 324..371 CDD:293791 7/27 (26%)
fbxa-169NP_001364654.1 HTH_48 9..58 CDD:465558
F-box_CeFBXA-like 74..>109 CDD:438921 11/34 (32%)
FTH 207..>301 CDD:396410
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.