DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and C31C9.9

DIOPT Version :10

Sequence 1:NP_609400.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001364527.1 Gene:C31C9.9 / 43578471 WormBaseID:WBGene00305095 Length:82 Species:Caenorhabditis elegans


Alignment Length:40 Identity:13/40 - (32%)
Similarity:22/40 - (55%) Gaps:0/40 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   367 LASFNDAKHSIVYMDLDEDRKRLLTVGQDRLIKIWDLSNI 406
            ||..::....|..:.|.|....|:|.|.:|:|.|||:.::
 Worm    35 LAIPHEIHTGITAIHLQETLGLLVTSGHNRVIMIWDVRSV 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_609400.1 WD40 24..279 CDD:475233
WD40 repeat 35..72 CDD:293791
WD40 repeat 80..117 CDD:293791
WD40 repeat 125..161 CDD:293791
WD40 repeat 166..205 CDD:293791
WD40 repeat 211..248 CDD:293791
WD40 repeat 253..283 CDD:293791
FYVE_WDFY1_like 287..356 CDD:277258
WD40 repeat 324..371 CDD:293791 2/3 (67%)
C31C9.9NP_001364527.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold <8..>31 CDD:469754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.