DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and Gga3

DIOPT Version :9

Sequence 1:NP_001188779.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_006247781.1 Gene:Gga3 / 360658 RGDID:1309553 Length:727 Species:Rattus norvegicus


Alignment Length:200 Identity:38/200 - (19%)
Similarity:68/200 - (34%) Gaps:59/200 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PAQRTNNDRFNTSKKPELLSKLEGSS--DDVNAAILIPGENGVISVSDDKTVRVWLKRDSGQYWP 69
            |..|..|..|:..:|.:||:||..|.  ||:..|              ::.::..:|.|..:   
  Rat   160 PPPRPKNPVFDDEEKSKLLAKLLRSKNPDDLQEA--------------NQLIKSMVKEDEAR--- 207

  Fly    70 SICQYMPSGCTAIEYVSES------------------------RHLYVGQENGTVTQYAL-SEDC 109
              .|.:......:|.|:.:                        :.|:...||...|.:.| ||..
  Rat   208 --IQKVTKRLHTLEEVNNNVKLLHEMLLHYSQEFSSEADKELMKELFDRCENKRRTLFKLASETE 270

  Fly   110 NRLSFLRDYLSHQARVMAVVFSKTHKWIL-----------SAGKDKQFAYHCTESGKRVGGYNFE 163
            :..:.|.|.|.....:..|:  .::|.|:           |...|.:...||...|..:.....:
  Rat   271 DNDNSLGDILQASDNLSRVI--NSYKTIIEGQIINGEVTTSTVPDSEGNSHCGNQGALIDLAELD 333

  Fly   164 TPCTA 168
            ||.::
  Rat   334 TPSSS 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_001188779.1 WD40 4..405 CDD:225201 38/199 (19%)
WD40 24..279 CDD:295369 33/182 (18%)
WD40 repeat 35..72 CDD:293791 3/36 (8%)
WD40 repeat 80..117 CDD:293791 10/61 (16%)
WD40 repeat 125..161 CDD:293791 8/46 (17%)
WD40 repeat 166..205 CDD:293791 0/2 (0%)
WD40 repeat 211..248 CDD:293791
WD40 repeat 253..283 CDD:293791
FYVE_WDFY1_like 287..356 CDD:277258
WD40 repeat 324..371 CDD:293791
Gga3XP_006247781.1 VHS_GGA 8..146 CDD:239624
GAT_GGA3 213..299 CDD:260098 15/87 (17%)
Alpha_adaptinC2 605..719 CDD:197886
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166334884
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.