Sequence 1: | NP_001188779.1 | Gene: | Wdfy2 / 34425 | FlyBaseID: | FBgn0032246 | Length: | 408 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006247781.1 | Gene: | Gga3 / 360658 | RGDID: | 1309553 | Length: | 727 | Species: | Rattus norvegicus |
Alignment Length: | 200 | Identity: | 38/200 - (19%) |
---|---|---|---|
Similarity: | 68/200 - (34%) | Gaps: | 59/200 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 PAQRTNNDRFNTSKKPELLSKLEGSS--DDVNAAILIPGENGVISVSDDKTVRVWLKRDSGQYWP 69
Fly 70 SICQYMPSGCTAIEYVSES------------------------RHLYVGQENGTVTQYAL-SEDC 109
Fly 110 NRLSFLRDYLSHQARVMAVVFSKTHKWIL-----------SAGKDKQFAYHCTESGKRVGGYNFE 163
Fly 164 TPCTA 168 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Wdfy2 | NP_001188779.1 | WD40 | 4..405 | CDD:225201 | 38/199 (19%) |
WD40 | 24..279 | CDD:295369 | 33/182 (18%) | ||
WD40 repeat | 35..72 | CDD:293791 | 3/36 (8%) | ||
WD40 repeat | 80..117 | CDD:293791 | 10/61 (16%) | ||
WD40 repeat | 125..161 | CDD:293791 | 8/46 (17%) | ||
WD40 repeat | 166..205 | CDD:293791 | 0/2 (0%) | ||
WD40 repeat | 211..248 | CDD:293791 | |||
WD40 repeat | 253..283 | CDD:293791 | |||
FYVE_WDFY1_like | 287..356 | CDD:277258 | |||
WD40 repeat | 324..371 | CDD:293791 | |||
Gga3 | XP_006247781.1 | VHS_GGA | 8..146 | CDD:239624 | |
GAT_GGA3 | 213..299 | CDD:260098 | 15/87 (17%) | ||
Alpha_adaptinC2 | 605..719 | CDD:197886 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166334884 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |