DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Wdfy2 and Tom1l2

DIOPT Version :9

Sequence 1:	NP_001188779.1	Gene:	Wdfy2 / 34425	FlyBaseID:	FBgn0032246	Length:	408	Species:	Drosophila melanogaster
Sequence 2:	XP_038942234.1	Gene:	Tom1l2 / 360537	RGDID:	1306728	Length:	592	Species:	Rattus norvegicus

Alignment Length:	144	Identity:	32/144 - (22%)
Similarity:	53/144 - (36%)	Gaps:	44/144 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly     1 MAAEIKPAQRTNND-----------RFNTSKKPELLSKLEGS---------SDDVNAAIL----- 40
            |..|:.|.|..::|           |....:..||:|::...         :||:|...|
  Rat   305 MLTEMVPGQEDSSDLELLQELNRTCRAMQHRIVELISRVSNEEVTEELLHVNDDLNNVFLRYERF 369

  Fly    41 ---------IPGENGVIS-VSDDKTVRVWLKRDSGQYWPSICQYMPSGCTA--IEYVSESRHLYV 93
                     ....|||:| |::|..:      |.|...|::...| .|.||  ....|:...|.:
  Rat   370 ERYRSGRSVQNASNGVLSEVTEDNLI------DLGPGSPAVVSPM-VGSTAPPSSLSSQLAGLDL 427

  Fly    94 GQENGTVTQYALSE 107
            |.|:.:.|..:|.:
  Rat   428 GTESVSGTLSSLQQ 441

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Wdfy2	NP_001188779.1	WD40	4..405	CDD:225201	31/141 (22%)
		WD40	24..279	CDD:295369	25/110 (23%)
		WD40 repeat	35..72	CDD:293791	11/51 (22%)
		WD40 repeat	80..117	CDD:293791	8/30 (27%)
		WD40 repeat	125..161	CDD:293791
		WD40 repeat	166..205	CDD:293791
		WD40 repeat	211..248	CDD:293791
		WD40 repeat	253..283	CDD:293791
		FYVE_WDFY1_like	287..356	CDD:277258
		WD40 repeat	324..371	CDD:293791
Tom1l2	XP_038942234.1	VHS_ENTH_ANTH	82..212	CDD:413366
Tom1l2	XP_038942234.1	GAT_TM1L2	282..373	CDD:410585	13/67 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166334885
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930