DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Wdfy2 and Gga1

DIOPT Version :9

Sequence 1:	NP_001188779.1	Gene:	Wdfy2 / 34425	FlyBaseID:	FBgn0032246	Length:	408	Species:	Drosophila melanogaster
Sequence 2:	XP_008763901.1	Gene:	Gga1 / 300066	RGDID:	1307770	Length:	635	Species:	Rattus norvegicus

Alignment Length:	120	Identity:	24/120 - (20%)
Similarity:	46/120 - (38%)	Gaps:	35/120 - (29%)

- Green bases have known domain annotations that are detailed below.

  Fly     7 PAQRTNNDRFNTSKKPELLSKLEGSS--DDVNAAILIPGENGVISVSDDKTVRVWLKRDSGQYWP 69
            |..|..|..|...:|.::|::|..||  :|:.||              :|.::..::.|..:
  Rat   160 PPPRPKNVIFEDEEKSKMLARLLKSSHPEDLRAA--------------NKLIKEMVQEDQKR--- 207

  Fly    70 SICQYMPSGCTAIEYVSES----RHLYVGQENGTVTQYALSED--------CNRL 112
              .:.:.....|||.|:.:    ..:.:....|..:  :.|||        |.|:
  Rat   208 --MEKISKRVNAIEEVNNNVKLLTEMVMSHSQGAAS--SSSEDLMKELYQRCERM 258

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Wdfy2	NP_001188779.1	WD40	4..405	CDD:225201	24/120 (20%)
		WD40	24..279	CDD:295369	19/103 (18%)
		WD40 repeat	35..72	CDD:293791	4/36 (11%)
		WD40 repeat	80..117	CDD:293791	10/45 (22%)
		WD40 repeat	125..161	CDD:293791
		WD40 repeat	166..205	CDD:293791
		WD40 repeat	211..248	CDD:293791
		WD40 repeat	253..283	CDD:293791
		FYVE_WDFY1_like	287..356	CDD:277258
		WD40 repeat	324..371	CDD:293791
Gga1	XP_008763901.1	VHS_GGA	9..147	CDD:239624
		DUF327	<180..234	CDD:294489	12/72 (17%)
		GAT_GGA1_GGA2	210..298	CDD:260097	10/51 (20%)
		Alpha_adaptinC2	513..627	CDD:197886
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C166334886
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930