DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and GGA1

DIOPT Version :9

Sequence 1:NP_001188779.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001350700.1 Gene:GGA1 / 26088 HGNCID:17842 Length:656 Species:Homo sapiens


Alignment Length:34 Identity:12/34 - (35%)
Similarity:19/34 - (55%) Gaps:2/34 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PAQRTNNDRFNTSKKPELLSKLEGSS--DDVNAA 38
            |..|..|..|...:|.::|::|..||  :|:.||
Human   177 PPPRPKNVIFEDEEKSKMLARLLKSSHPEDLRAA 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_001188779.1 WD40 4..405 CDD:225201 12/34 (35%)
WD40 24..279 CDD:295369 7/17 (41%)
WD40 repeat 35..72 CDD:293791 2/4 (50%)
WD40 repeat 80..117 CDD:293791
WD40 repeat 125..161 CDD:293791
WD40 repeat 166..205 CDD:293791
WD40 repeat 211..248 CDD:293791
WD40 repeat 253..283 CDD:293791
FYVE_WDFY1_like 287..356 CDD:277258
WD40 repeat 324..371 CDD:293791
GGA1NP_001350700.1 VHS_GGA 9..164 CDD:239624
GAT_GGA1_GGA2 227..316 CDD:260097
Alpha_adaptinC2 534..648 CDD:197886
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141221
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.