DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and GGA3

DIOPT Version :10

Sequence 1:NP_609400.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_619525.1 Gene:GGA3 / 23163 HGNCID:17079 Length:723 Species:Homo sapiens


Alignment Length:120 Identity:25/120 - (20%)
Similarity:42/120 - (35%) Gaps:44/120 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PAQRTNNDRFNTSKKPELLSKLEGSS--DDVNAAILIPGENGVISVSDDKTVRVWLKRDSGQYWP 69
            |..|..|..|:..:|.:||:||..|.  ||:..|              :|.::..:|.|..:   
Human   160 PPPRPKNPVFDDEEKSKLLAKLLKSKNPDDLQEA--------------NKLIKSMVKEDEAR--- 207

  Fly    70 SICQYMPSGCTAIEYVSESRHLYVGQENGTVTQYALSEDCNRLSFLRDYLSHQAR 124
                        |:.|::..|             .|.|..|.:..|.:.|.|.::
Human   208 ------------IQKVTKRLH-------------TLEEVNNNVRLLSEMLLHYSQ 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_609400.1 WD40 24..279 CDD:475233 20/103 (19%)
WD40 repeat 35..72 CDD:293791 4/36 (11%)
WD40 repeat 80..117 CDD:293791 7/36 (19%)
WD40 repeat 125..161 CDD:293791 25/120 (21%)
WD40 repeat 166..205 CDD:293791
WD40 repeat 211..248 CDD:293791
WD40 repeat 253..283 CDD:293791
FYVE_WDFY1_like 287..356 CDD:277258
WD40 repeat 324..371 CDD:293791
GGA3NP_619525.1 Binds to ARF1 (in long isoform) 1..313 25/120 (21%)
VHS_GGA3 6..146 CDD:340805
GGA_N-GAT 169..207 CDD:465702 13/51 (25%)
GAT_GGA3 213..299 CDD:410587 7/38 (18%)
Unstructured hinge 299..593
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 339..384
DXXLL. /evidence=ECO:0000269|PubMed:12060753 391..395
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 428..464
Alpha_adaptinC2 601..715 CDD:197886
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.