DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and Tom1

DIOPT Version :10

Sequence 1:NP_609400.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_001129731.1 Gene:Tom1 / 21968 MGIID:1338026 Length:516 Species:Mus musculus


Alignment Length:64 Identity:16/64 - (25%)
Similarity:23/64 - (35%) Gaps:10/64 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PELLSKLEGSSDDVNAAI-LIPGENGVISVSDDKTVRVWLKRDSGQYWPSICQYMPSGCTAIEY 84
            |:....|.|:.|....:. .||.....|.    :.:..||..|.|.     ....|||.|:.|:
Mouse   413 PQTTDGLAGALDARQQSTGAIPATQARIM----EDIEQWLSTDVGN-----SAEEPSGVTSEEF 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_609400.1 WD40 24..279 CDD:475233 15/62 (24%)
WD40 repeat 35..72 CDD:293791 7/37 (19%)
WD40 repeat 80..117 CDD:293791 2/5 (40%)
WD40 repeat 125..161 CDD:293791
WD40 repeat 166..205 CDD:293791
WD40 repeat 211..248 CDD:293791
WD40 repeat 253..283 CDD:293791
FYVE_WDFY1_like 287..356 CDD:277258
WD40 repeat 324..371 CDD:293791
Tom1NP_001129731.1 VHS_Tom1 12..148 CDD:340792
GAT_TOM1 214..308 CDD:260094
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.