DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Wdfy2 and ZK632.12

DIOPT Version :9

Sequence 1:	NP_001188779.1	Gene:	Wdfy2 / 34425	FlyBaseID:	FBgn0032246	Length:	408	Species:	Drosophila melanogaster
Sequence 2:	NP_499183.1	Gene:	ZK632.12 / 176397	WormBaseID:	WBGene00014019	Length:	266	Species:	Caenorhabditis elegans

Alignment Length:	76	Identity:	24/76 - (31%)
Similarity:	35/76 - (46%)	Gaps:	14/76 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   289 WV---DTNNCQLCSRPFFWNFRSMMDQKQLGIRQHHCRHCGKAVCDNCSTNRINIPIMGFEFDVR 350
            ||   :...|.:|.:..|          .|..|:||||:||:.||..||:....|..: .:..||
Worm   149 WVPDGEAVKCMVCGKTQF----------NLVQRRHHCRNCGRVVCGACSSRTFRIDNV-HKKPVR 202

  Fly   351 TCDPCYKQLQT 361
            .||.|:..|.:
Worm   203 VCDHCFDSLSS 213

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Wdfy2	NP_001188779.1	WD40	4..405	CDD:225201	24/76 (32%)
		WD40	24..279	CDD:295369
		WD40 repeat	35..72	CDD:293791
		WD40 repeat	80..117	CDD:293791
		WD40 repeat	125..161	CDD:293791
		WD40 repeat	166..205	CDD:293791
		WD40 repeat	211..248	CDD:293791
		WD40 repeat	253..283	CDD:293791
		FYVE_WDFY1_like	287..356	CDD:277258	22/69 (32%)
		WD40 repeat	324..371	CDD:293791	13/38 (34%)
ZK632.12	NP_499183.1	PH_Phafin2-like	7..129	CDD:269927
		PH	39..130	CDD:278594
		FYVE_PKHF	148..208	CDD:277257	22/69 (32%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000