DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and Gga1

DIOPT Version :10

Sequence 1:NP_609400.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:NP_666041.1 Gene:Gga1 / 106039 MGIID:2146207 Length:635 Species:Mus musculus


Alignment Length:120 Identity:24/120 - (20%)
Similarity:46/120 - (38%) Gaps:35/120 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PAQRTNNDRFNTSKKPELLSKLEGSS--DDVNAAILIPGENGVISVSDDKTVRVWLKRDSGQYWP 69
            |..|..|..|...:|.::|::|..||  :|:.||              :|.::..::.|..:   
Mouse   160 PPPRPKNVIFEDEEKSKMLARLLKSSHPEDLRAA--------------NKLIKEMVQEDQKR--- 207

  Fly    70 SICQYMPSGCTAIEYVSES----RHLYVGQENGTVTQYALSED--------CNRL 112
              .:.:.....|||.|:.:    ..:.:....|..:  :.|||        |.|:
Mouse   208 --MEKISKRVNAIEEVNNNVKLLTEMVMSHSQGAAS--SSSEDLMKELYQRCERM 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_609400.1 WD40 24..279 CDD:475233 19/103 (18%)
WD40 repeat 35..72 CDD:293791 4/36 (11%)
WD40 repeat 80..117 CDD:293791 10/45 (22%)
WD40 repeat 125..161 CDD:293791
WD40 repeat 166..205 CDD:293791
WD40 repeat 211..248 CDD:293791
WD40 repeat 253..283 CDD:293791
FYVE_WDFY1_like 287..356 CDD:277258
WD40 repeat 324..371 CDD:293791
Gga1NP_666041.1 VHS_GGA1 9..147 CDD:340806
Interaction with ARF3. /evidence=ECO:0000250 114..273 24/120 (20%)
GGA_N-GAT 169..207 CDD:465702 11/51 (22%)
GAT_GGA1_GGA2 210..297 CDD:410586 10/51 (20%)
Unstructured hinge 299..505
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..349
Autoinhibitory. /evidence=ECO:0000250 357..361
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..422
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 455..490
Alpha_adaptinC2 513..627 CDD:197886
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.