DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Wdfy2 and STAM2

DIOPT Version :9

Sequence 1:	NP_001188779.1	Gene:	Wdfy2 / 34425	FlyBaseID:	FBgn0032246	Length:	408	Species:	Drosophila melanogaster
Sequence 2:	NP_005834.4	Gene:	STAM2 / 10254	HGNCID:	11358	Length:	525	Species:	Homo sapiens

Alignment Length:	86	Identity:	21/86 - (24%)
Similarity:	32/86 - (37%)	Gaps:	21/86 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   108 DCNRLSFL----RDYLSHQARVMAVVFSKTH------------KWILSAGKDKQFA-YHCTESGK 155
            :|.::..|    ||:.:   .|.||:.:|.|            :|.....||.||: ...|....
Human    75 NCGKIFHLEVCSRDFAT---EVRAVIKNKAHPKVCEKLKSLMVEWSEEFQKDPQFSLISATIKSM 136

  Fly   156 RVGGYNFETPCTALQFDALAK 176
            :..|..| .|..:....|.||
Human   137 KEEGITF-PPAGSQTVSAAAK 156

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Wdfy2	NP_001188779.1	WD40	4..405	CDD:225201	21/86 (24%)
		WD40	24..279	CDD:295369	21/86 (24%)
		WD40 repeat	35..72	CDD:293791
		WD40 repeat	80..117	CDD:293791	2/12 (17%)
		WD40 repeat	125..161	CDD:293791	12/48 (25%)
		WD40 repeat	166..205	CDD:293791	3/11 (27%)
		WD40 repeat	211..248	CDD:293791
		WD40 repeat	253..283	CDD:293791
		FYVE_WDFY1_like	287..356	CDD:277258
		WD40 repeat	324..371	CDD:293791
STAM2	NP_005834.4	VHS_STAM	9..143	CDD:239625	16/70 (23%)
		PxVxL motif	54..67
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	143..167		5/15 (33%)
		UIM	166..181	CDD:280900
		SH3_STAM2	204..260	CDD:212896
		Interaction with USP8. /evidence=ECO:0000250	219..220
		GAT	296..367	CDD:281166
		Interaction with HGS. /evidence=ECO:0000250	334..368
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165141216
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930