DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Wdfy2 and tom1l2

DIOPT Version :9

Sequence 1:	NP_001188779.1	Gene:	Wdfy2 / 34425	FlyBaseID:	FBgn0032246	Length:	408	Species:	Drosophila melanogaster
Sequence 2:	XP_009298168.1	Gene:	tom1l2 / 100535615	-ID:	-	Length:	551	Species:	Danio rerio

Alignment Length:	134	Identity:	28/134 - (20%)
Similarity:	42/134 - (31%)	Gaps:	48/134 - (35%)

- Green bases have known domain annotations that are detailed below.

  Fly     6 KPAQRT----NNDRFNT-----SKKPELLSKLEGSSDDVNAAI---------LIPGENGVISVSD 52
            |||...    ||....|     |..||.:::|....|.|...|         ::||:.....:
Zfish   194 KPAAAAAPVFNNTHIQTAAGPISANPEQIARLRSELDIVRGNIKVMSEMLTEMVPGQEDASDL-- 256

  Fly    53 DKTVRVWLKRDSGQYWPSICQYMPSGCTA-----IEYVSESRHLYVGQENGTVTQYALSEDCNRL 112
                             .:.|.:...|.|     :|.:|.     |..|..|......::|.|.:
Zfish   257 -----------------ELLQELNRTCRAMQHRIVELISR-----VSNEEVTEELLHANDDLNNM 299

  Fly   113 SFLR 116
             |||
Zfish   300 -FLR 302

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Wdfy2	NP_001188779.1	WD40	4..405	CDD:225201	28/134 (21%)
		WD40	24..279	CDD:295369	19/107 (18%)
		WD40 repeat	35..72	CDD:293791	4/45 (9%)
		WD40 repeat	80..117	CDD:293791	11/42 (26%)
		WD40 repeat	125..161	CDD:293791
		WD40 repeat	166..205	CDD:293791
		WD40 repeat	211..248	CDD:293791
		WD40 repeat	253..283	CDD:293791
		FYVE_WDFY1_like	287..356	CDD:277258
		WD40 repeat	324..371	CDD:293791
tom1l2	XP_009298168.1	VHS_Tom1	12..152	CDD:239623
tom1l2	XP_009298168.1	GAT_SF	219..310	CDD:296121	21/109 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170574129
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930