DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Wdfy2 and TOM1

DIOPT Version :9

Sequence 1:	NP_001188779.1	Gene:	Wdfy2 / 34425	FlyBaseID:	FBgn0032246	Length:	408	Species:	Drosophila melanogaster
Sequence 2:	NP_001129204.1	Gene:	TOM1 / 10043	HGNCID:	11982	Length:	493	Species:	Homo sapiens

Alignment Length:	73	Identity:	19/73 - (26%)
Similarity:	28/73 - (38%)	Gaps:	14/73 - (19%)

- Green bases have known domain annotations that are detailed below.

  Fly    95 QENGT--VTQYALSEDCNRLSFLRDYLSHQARVMAVVFSKTHKWILSAGKDKQFAYHCTESGKRV 157
            |..|.  |||..|.||      :..:||......|    :..|.:.|.||..:|.....::..|:
Human   404 QSTGAIPVTQACLMED------IEQWLSTDVGNDA----EEPKGVTSEGKFDKFLEERAKAADRL 458

  Fly   158 GGYNFETP 165
            .  |..:|
Human   459 P--NLSSP 464

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Wdfy2	NP_001188779.1	WD40	4..405	CDD:225201	19/73 (26%)
		WD40	24..279	CDD:295369	19/73 (26%)
		WD40 repeat	35..72	CDD:293791
		WD40 repeat	80..117	CDD:293791	8/23 (35%)
		WD40 repeat	125..161	CDD:293791	7/35 (20%)
		WD40 repeat	166..205	CDD:293791	19/73 (26%)
		WD40 repeat	211..248	CDD:293791
		WD40 repeat	253..283	CDD:293791
		FYVE_WDFY1_like	287..356	CDD:277258
		WD40 repeat	324..371	CDD:293791
TOM1	NP_001129204.1	VHS_Tom1	12..152	CDD:239623
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	171..212
		GAT_TOM1	214..308	CDD:260094
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	307..336
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C165141214
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.930