DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Wdfy2 and gga3b

DIOPT Version :9

Sequence 1:	NP_001188779.1	Gene:	Wdfy2 / 34425	FlyBaseID:	FBgn0032246	Length:	408	Species:	Drosophila melanogaster
Sequence 2:	XP_009297383.1	Gene:	gga3b / 100334661	ZFINID:	ZDB-GENE-131126-18	Length:	709	Species:	Danio rerio

Alignment Length:	36	Identity:	12/36 - (33%)
Similarity:	19/36 - (52%)	Gaps:	3/36 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    41 IPGENGVISVSDDKTVRVWLKRDSGQYWPSICQYMP 76
            :|..|.|:..:..|::||.|:..||   ..||.:.|
Zfish   623 LPVRNVVLQAAVPKSMRVKLQPPSG---TEICPFNP 655

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Wdfy2	NP_001188779.1	WD40	4..405	CDD:225201	12/36 (33%)
		WD40	24..279	CDD:295369	12/36 (33%)
		WD40 repeat	35..72	CDD:293791	9/30 (30%)
		WD40 repeat	80..117	CDD:293791
		WD40 repeat	125..161	CDD:293791
		WD40 repeat	166..205	CDD:293791
		WD40 repeat	211..248	CDD:293791
		WD40 repeat	253..283	CDD:293791
		FYVE_WDFY1_like	287..356	CDD:277258
		WD40 repeat	324..371	CDD:293791
gga3b	XP_009297383.1	VHS_GGA	11..148	CDD:239624
		PARP_reg	<133..207	CDD:280950
		GAT_GGA3	215..301	CDD:260098
		Alpha_adaptinC2	588..701	CDD:197886	12/36 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C170574128
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.930