DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wdfy2 and gga3b

DIOPT Version :10

Sequence 1:NP_609400.1 Gene:Wdfy2 / 34425 FlyBaseID:FBgn0032246 Length:408 Species:Drosophila melanogaster
Sequence 2:XP_009297383.1 Gene:gga3b / 100334661 ZFINID:ZDB-GENE-131126-18 Length:709 Species:Danio rerio


Alignment Length:36 Identity:12/36 - (33%)
Similarity:19/36 - (52%) Gaps:3/36 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 IPGENGVISVSDDKTVRVWLKRDSGQYWPSICQYMP 76
            :|..|.|:..:..|::||.|:..||   ..||.:.|
Zfish   623 LPVRNVVLQAAVPKSMRVKLQPPSG---TEICPFNP 655

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wdfy2NP_609400.1 WD40 24..279 CDD:475233 12/36 (33%)
WD40 repeat 35..72 CDD:293791 9/30 (30%)
WD40 repeat 80..117 CDD:293791
WD40 repeat 125..161 CDD:293791
WD40 repeat 166..205 CDD:293791
WD40 repeat 211..248 CDD:293791
WD40 repeat 253..283 CDD:293791
FYVE_WDFY1_like 287..356 CDD:277258
WD40 repeat 324..371 CDD:293791
gga3bXP_009297383.1 VHS_ENTH_ANTH 9..148 CDD:470608
GGA_N-GAT 171..209 CDD:465702
GAT_GGA3 215..301 CDD:410587
Alpha_adaptinC2 588..701 CDD:197886 12/36 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.