DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC3 and EMB1968

DIOPT Version :9

Sequence 1:NP_609399.1 Gene:RfC3 / 34423 FlyBaseID:FBgn0032244 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001185061.1 Gene:EMB1968 / 838771 AraportID:AT1G21690 Length:341 Species:Arabidopsis thaliana


Alignment Length:312 Identity:124/312 - (39%)
Similarity:177/312 - (56%) Gaps:23/312 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PWVEKYRPSGLDDLISHEEIISTITRFISRKQLPHLLFYGPPGTGKTSTILACARQLYSPQQFKS 76
            ||||||||..:.|:...||::..:|..:.....||:|||||||||||:|.||.|.||:.|:.:||
plant    10 PWVEKYRPKQVKDVAHQEEVVRVLTNTLQTADCPHMLFYGPPGTGKTTTALAIAHQLFGPELYKS 74

  Fly    77 MVLELNASDDRGIGIVRGQILNFASTRT--------IFCDTFKLIILDEADAMTNDAQNALRRII 133
            .||||||||||||.:||.:|.:||:...        ..|.:||:|||||||:||.||||||||.:
plant    75 RVLELNASDDRGINVVRTKIKDFAAVAVGSNHRQSGYPCPSFKIIILDEADSMTEDAQNALRRTM 139

  Fly   134 EKYTDNVRFCVICNYLSKIIPALQSRCTRFRFAPLSQDQMMPRLEKIIEAEAVQITEDGKRALLT 198
            |.|:...||..||||:|:||..|.|||.:|||.|||::.|..|:..|...|.:.:..:....|.:
plant   140 ETYSKVTRFFFICNYISRIIEPLASRCAKFRFKPLSEEVMSNRILHICNEEGLSLDGEALSTLSS 204

  Fly   199 LAKGDMRKVLNVLQSTVMAF-DTVNEDNVYMCVGYPLRQDIEQILKALLSGSSLEDSFKTVESAK 262
            :::||:|:.:..|||....| .|:...::....|....:.:.::..|..|| ..:.:.|.|::. 
plant   205 ISQGDLRRAITYLQSATRLFGSTITSTDLLNVSGVVPLEVVNKLFTACKSG-DFDIANKEVDNI- 267

  Fly   263 YARGLALEDIITELHLFVMRLELPMSVMNKLIVKLAQIEERLAKGCTEVAQT 314
            .|.|.....||.:|...|...:..::.|.|            ||.|..:|:|
plant   268 VAEGYPASQIINQLFDIVAEADSDITDMQK------------AKICKCLAET 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC3NP_609399.1 rfc 12..321 CDD:234763 124/312 (40%)
EMB1968NP_001185061.1 PRK12402 11..308 CDD:237090 123/311 (40%)
AAA 26..166 CDD:99707 75/139 (54%)
AAA_assoc_2 189..>220 CDD:292811 7/30 (23%)
Rep_fac_C 256..>309 CDD:285713 15/65 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53599
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 1 1.000 - - FOG0000505
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.