DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC3 and AT1G14460

DIOPT Version :9

Sequence 1:NP_609399.1 Gene:RfC3 / 34423 FlyBaseID:FBgn0032244 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_172898.2 Gene:AT1G14460 / 838008 AraportID:AT1G14460 Length:1116 Species:Arabidopsis thaliana


Alignment Length:312 Identity:69/312 - (22%)
Similarity:131/312 - (41%) Gaps:31/312 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EKYRPSGLDDLISHEEIISTITRFISRKQLPHL-LFYGPPGTGKTST--ILACA----------- 65
            :||:|...|:||....::.::...:.:.::.|: ||.||.|||||||  ||:.|           
plant   426 QKYKPMFFDELIGQSIVVQSLMNAVKKGRVAHVYLFQGPRGTGKTSTARILSAALNCDVVTEEMK 490

  Fly    66 -----RQLYSPQQFKSM-VLELNASDDRGIGIVRGQILNFASTRTIFCDTFKLIILDEADAMTND 124
                 ::.......||. :|||:|....|...||..:....:........:|:.::||...:.:.
plant   491 PCGYCKECSDYMLGKSRDLLELDAGKKNGAEKVRYLLKKLLTLAPQSSQRYKVFVIDECHLLPSR 555

  Fly   125 AQNALRRIIEKYTDNVRFCVICNYLSKIIPALQSRCTRFRFAPLSQDQMMPRLEKIIEAEAVQIT 189
            ...:|.:.:|.......|..|...|..:...:||||.::.|..:....::.||.||...|.:.:.
plant   556 TWLSLLKFLENPLQKFVFVCITTDLDNVPRTIQSRCQKYIFNKVRDGDIVVRLRKIASDENLDVE 620

  Fly   190 EDGKRALLTLAKGDMRKVLNVLQSTVMAFDTVNEDNVYMCVGYPLRQDIEQILKALLSGSSLEDS 254
            ......:...|.|.:|....:|:...:....:..|.|...||......:.::|:..||    .|:
plant   621 SQALDLIALNADGSLRDAETMLEQLSLMGKRITVDLVNELVGVVSDDKLLELLELALS----SDT 681

  Fly   255 FKTVESAKYARGLALEDIITELHLFVMRLELPMSVMNKLIVKLAQIEERLAK 306
            .:||:.|:....|..:.|:       |..:|...:|:.:......::|:.::
plant   682 AETVKKARELLDLGADPIL-------MMSQLASLIMDIIAGAYKALDEKYSE 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC3NP_609399.1 rfc 12..321 CDD:234763 69/312 (22%)
AT1G14460NP_172898.2 dnaX_nterm 422..773 CDD:274111 69/312 (22%)
AAA 459..596 CDD:278434 35/136 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.