DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC3 and Rfc3

DIOPT Version :9

Sequence 1:NP_609399.1 Gene:RfC3 / 34423 FlyBaseID:FBgn0032244 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_081285.1 Gene:Rfc3 / 69263 MGIID:1916513 Length:356 Species:Mus musculus


Alignment Length:367 Identity:99/367 - (26%)
Similarity:152/367 - (41%) Gaps:89/367 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WVEKYRPSGLDDLISHEEIISTITRFISRKQLPHLLFYGPPGTGKTSTILACARQLY-------- 69
            ||:|||||.|..|..|:|..:.:...:.....||||.|||.|.||.:.|:...|:||        
Mouse     4 WVDKYRPSSLARLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGIGVEKLR 68

  Fly    70 -------SPQQFKSMV--------LELNASD----DRGI------GIVRGQILNFASTRTIFCDT 109
                   :|.:.|..:        ||:|.||    ||.:      .:.:.|.|..:|.|     .
Mouse    69 IEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETSSQR-----D 128

  Fly   110 FKLIILDEADAMTNDAQNALRRIIEKYTDNVRFCVICNYLSKIIPALQSRCTRFRFAPLSQDQMM 174
            ||:::|.|.|.:|.|||:||||.:|||....|..:.||..||:||.::|||...|....|.:.:.
Mouse   129 FKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDIC 193

  Fly   175 PRLEKIIEAEAVQITEDGKRALLTLAKGDMRKVLNVLQSTVMAFDTVNEDNVYMCVG-----YPL 234
            ..|..:...|.:.:.....|.|...:..::||.|                  .||..     ||.
Mouse   194 SVLSTVCRKEGLALPSTLARRLAEKSCRNLRKAL------------------LMCEACRVQQYPF 240

  Fly   235 RQD-----------IEQILKALLSGSSLEDSFKTVESAKYARGLALEDIIT-----ELHLFVMRL 283
            .:|           :.:...|::|.       :|.:.....|| .|.:::|     |:.:..:..
Mouse   241 TEDQEIPETDWEVYLRETANAIVSQ-------QTPQRLLEVRG-RLYELLTHCIPPEIIMKGLLS 297

  Fly   284 ELPMSVMNKLIVKLAQI----EERLAKGCTEVAQTAALVAAF 321
            ||..:...:|..::||:    |.||..|...:....|.||.|
Mouse   298 ELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC3NP_609399.1 rfc 12..321 CDD:234763 98/365 (27%)
Rfc3NP_081285.1 PRK12402 3..339 CDD:237090 98/365 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.