DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC3 and RfC38

DIOPT Version :9

Sequence 1:NP_609399.1 Gene:RfC3 / 34423 FlyBaseID:FBgn0032244 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001285833.1 Gene:RfC38 / 34550 FlyBaseID:FBgn0028700 Length:356 Species:Drosophila melanogaster


Alignment Length:360 Identity:94/360 - (26%)
Similarity:154/360 - (42%) Gaps:75/360 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WVEKYRPSGLDDLISHEEIISTITRFISRKQLPHLLFYGPPGTGKTSTILACARQLY-------- 69
            ||:||||..|..|..|::....:.....:...|||:||||.|.||.:.|:...|::|        
  Fly     4 WVDKYRPRELSKLDFHKDQAENLRNLCKQSDFPHLMFYGPSGAGKKTRIMCLLREMYGSGVERLR 68

  Fly    70 -------SPQQFKSMV--------LELNASD----DRGIGIVRGQILNFASTRTIFCD---TFKL 112
                   :|...|..|        ||:|.||    ||  .:|...|...|.|..|...   .||:
  Fly    69 SETMTFTTPSNRKVEVMTVSSNYHLEVNPSDAGMYDR--TVVIDLIKQVAQTHQIEISGQREFKV 131

  Fly   113 IILDEADAMTNDAQNALRRIIEKYTDNVRFCVICNYLSKIIPALQSRCTRFRFAPLSQDQMMPRL 177
            |::.|.|.:|.|||:||||.:|||....|..:..|..|:||||::|||...|.|..::.:::..|
  Fly   132 IVISEGDELTKDAQHALRRTMEKYVATCRIIISVNSTSRIIPAIRSRCLGIRVAAPNETEIVSIL 196

  Fly   178 EKIIEAEAVQITEDGKRALLTLAKGDMRKVLNVLQSTVMA---FDTVNED------NVYMCVGYP 233
            :...:.|.:.:..:..:.::..::.::|:.|.:|::..:|   | |.|::      .|:      
  Fly   197 QNTCKREGLALPVELAKRVVDKSERNLRRALLMLEAAKVAKAPF-TANQEIPDLDWQVF------ 254

  Fly   234 LRQDIEQILKALLSGSSLEDSFKTVESAKYA------------RGLALEDIITELHLFVMRLELP 286
            ||:...||:     ........:.:....|.            ||| :|.::.         ...
  Fly   255 LRETASQII-----SEQTPAKLEKIRERLYELLTQGVPPNLIFRGL-VEQLVN---------NCD 304

  Fly   287 MSVMNKLIVKLAQIEERLAKGCTEVAQTAALVAAF 321
            ||:..|.:....:.|.|:..|...:....|.||.|
  Fly   305 MSIKAKTLEFATEYEHRMQSGAKHIFHLEAFVAQF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC3NP_609399.1 rfc 12..321 CDD:234763 93/358 (26%)
RfC38NP_001285833.1 rfc 3..345 CDD:234763 94/360 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455782
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I449
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11669
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.