DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC3 and Rad17

DIOPT Version :9

Sequence 1:NP_609399.1 Gene:RfC3 / 34423 FlyBaseID:FBgn0032244 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001019949.1 Gene:Rad17 / 310034 RGDID:1309515 Length:686 Species:Rattus norvegicus


Alignment Length:261 Identity:67/261 - (25%)
Similarity:109/261 - (41%) Gaps:69/261 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PWVEKYRPSGLDDLISHEEIISTITRFISRKQL----PH----LLFYGPPGTGKTSTILACARQL 68
            |||:||:|....:|..|::.|..:..::..:.|    .|    ||..||||.|||:||...:::|
  Rat    89 PWVDKYKPETQHELAVHKKKIEEVETWLKTQVLEVKPKHGGSILLITGPPGCGKTTTIKILSKEL 153

  Fly    69 -YSPQQFKSMVLELNASDDRGIGIVRGQILN---------FASTRTIFCDTF-------KLIILD 116
             ...|::.:.:|:....||      ..::.|         :.|...:|.|..       ||.:| 
  Rat   154 GIQVQEWVNPILQDFQKDD------YKELFNSESNFSVIPYQSQIAVFNDFLLRATKYNKLQML- 211

  Fly   117 EADAMTNDAQ---------------NALRRIIEKYTDNVRFCVICNYLSKIIPA----------- 155
             .||:|.|.:               |||..|:.||. ::..|.:...:|..:..           
  Rat   212 -GDALTTDKKIILVEDLPNQFYRDANALHEILRKYV-HIGRCPLVFIVSDSVSGDSNHRLLFPKN 274

  Fly   156 LQSRC--TRFRFAPLSQDQMMPRLEKIIEAEA----VQITEDGKRALLTLAK---GDMRKVLNVL 211
            :|..|  :...|.|::...||..|.:|:..||    .:||...|.:|..|.:   ||:|..:|.|
  Rat   275 IQEECSVSNISFNPVAPTIMMKFLNRIVTIEASKNGEKITVPNKASLELLCQGCSGDIRSAINSL 339

  Fly   212 Q 212
            |
  Rat   340 Q 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC3NP_609399.1 rfc 12..321 CDD:234763 67/261 (26%)
Rad17NP_001019949.1 rad24 13..651 CDD:129690 67/261 (26%)
AAA_18 133..>253 CDD:289979 33/128 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.