DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC3 and Rfc4

DIOPT Version :9

Sequence 1:NP_609399.1 Gene:RfC3 / 34423 FlyBaseID:FBgn0032244 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_001099339.1 Gene:Rfc4 / 288003 RGDID:1310142 Length:364 Species:Rattus norvegicus


Alignment Length:321 Identity:136/321 - (42%)
Similarity:194/321 - (60%) Gaps:16/321 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MPWVEKYRPSGLDDLISHEEIISTITRFISRKQLPHLLFYGPPGTGKTSTILACARQLYSPQQFK 75
            :||||||||..:|::...||:::.:.:.:....||:|||||||||||||||||.||:|:.|:.|:
  Rat    38 VPWVEKYRPKCVDEVAFQEEVVAVLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFR 102

  Fly    76 SMVLELNASDDRGIGIVRGQILNFASTRTIF--------CDTFKLIILDEADAMTNDAQNALRRI 132
            ..||||||||:|||.:||.::.|||.. |:.        |..||::||||||:||:.||.||||.
  Rat   103 LRVLELNASDERGIQVVREKVKNFAQL-TVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRT 166

  Fly   133 IEKYTDNVRFCVICNYLSKIIPALQSRCTRFRFAPLSQDQMMPRLEKIIEAEAVQITEDGKRALL 197
            :||.:...|||:||||:|:||..|.|||::|||.|||......||..|.|.|.|:|.::....|:
  Rat   167 MEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQKRLLDIAEKENVKIGDEEIAYLV 231

  Fly   198 TLAKGDMRKVLNVLQST--VMAFDTVNEDNVYMCVGYPLRQDIEQILKALLSGSSLEDSFKTVES 260
            .:::||:||.:..|||.  :.....::||.:....|......||.|:.|..|||.  |..:.|..
  Rat   232 RISEGDLRKAITFLQSATRLTGGKEISEDVITDIAGVIPAATIEGIVTACHSGSF--DKLEAVLK 294

  Fly   261 AKYARGLALEDIITELHLFVMRLELPMSVMNKLIV--KLAQIEERLAKGCTEVAQTAALVA 319
            .....|.|...::.:||..::..| .:|...|.|:  |||::::.||.|..|..|..:|.|
  Rat   295 NLIDEGHAATQLVNQLHDSIIEDE-NLSDKQKSIITEKLAEVDKCLADGADEHLQLMSLCA 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC3NP_609399.1 rfc 12..321 CDD:234763 136/320 (43%)
Rfc4NP_001099339.1 rfc 39..354 CDD:234763 135/318 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53599
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 1 1.000 - - FOG0000505
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.