DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC3 and rfc-3

DIOPT Version :9

Sequence 1:NP_609399.1 Gene:RfC3 / 34423 FlyBaseID:FBgn0032244 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_502517.1 Gene:rfc-3 / 178259 WormBaseID:WBGene00004339 Length:354 Species:Caenorhabditis elegans


Alignment Length:351 Identity:100/351 - (28%)
Similarity:160/351 - (45%) Gaps:54/351 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 WVEKYRPS---GLDDLISHEEIISTITRFISRKQLPHLLFYGPPGTGKTSTILACARQLY----- 69
            ||:||||.   |.|.:..|.|..:.: :|:|...:|||||.||.|.||.:.|....|:||     
 Worm     4 WVDKYRPKDLLGKDGVDYHIEQANHL-KFLSADCMPHLLFCGPSGAGKKTRIKCLLRELYGVGVE 67

  Fly    70 ----------SPQQFKSMV--------LELNASDDRGIGI-----VRGQILNFASTRTIFCD--- 108
                      ||...|..:        :|:..||   :||     |:..:...|.|..|...   
 Worm    68 KTQLIMKSFTSPSNKKLEIQTVSSNYHIEMTPSD---VGIYDRVVVQDLVKEMAQTSQIESTSQR 129

  Fly   109 TFKLIILDEADAMTNDAQNALRRIIEKYTDNVRFCVICNYLSKIIPALQSRCTRFRFAPLSQDQM 173
            :||:::|.|||::|.|||:.|||.:|||.:|.:..:.|..||:||..|||||........:.:.:
 Worm   130 SFKVVVLCEADSLTRDAQHGLRRTMEKYANNCKIVLSCESLSRIIEPLQSRCIIINVPAPTDEDV 194

  Fly   174 MPRLEKIIEAEAVQITEDGKRALLTLAKGDMRKVLNVLQSTVMAFDTVNEDNVYMCVGYPLRQ-- 236
            ...|.|:||.|:..:.|:..:.::..::|::|:.:.:.::..|.    ||..|...|..|:.:  
 Worm   195 TKVLRKVIERESFLLPENVLQKIVEKSEGNLRRAILMTEALRME----NESGVAESVVIPVPEWE 255

  Fly   237 -DIEQILKALLSGSSLEDSFKTVESAKYARGLALEDIITELHLFVMRLE-----LPMSVMNKLIV 295
             .|::..:.:|...| .|....|....|.   .|...|....:|...||     .|..:..:::.
 Worm   256 IYIQETARLILQKQS-SDMLLKVRERLYE---LLSRCIPPTVIFKKLLEHLLPKCPPQIAREVVS 316

  Fly   296 KLAQIEERLAKGCTEVAQTAALVAAF 321
            :.|:.|.||..|...:......||||
 Worm   317 EAAKFEHRLVLGQKAIFHLEGFVAAF 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC3NP_609399.1 rfc 12..321 CDD:234763 98/349 (28%)
rfc-3NP_502517.1 PRK12402 3..342 CDD:237090 98/349 (28%)
AAA 38..187 CDD:99707 53/151 (35%)
Rep_fac_C 253..340 CDD:285713 17/90 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1071197at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.