DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RfC3 and hpr-17

DIOPT Version :9

Sequence 1:NP_609399.1 Gene:RfC3 / 34423 FlyBaseID:FBgn0032244 Length:332 Species:Drosophila melanogaster
Sequence 2:NP_496793.1 Gene:hpr-17 / 174958 WormBaseID:WBGene00001998 Length:514 Species:Caenorhabditis elegans


Alignment Length:364 Identity:77/364 - (21%)
Similarity:134/364 - (36%) Gaps:91/364 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PSGLDDLISHEEIISTITRFI------SRKQLPHLLFYGPPGTGKTSTI-LACARQ-----LYSP 71
            |...|:|..|.:.|:.:..::      |.|||..:...||.|:||::|: :.|..|     .|||
 Worm    15 PRRRDELQIHNKKIAEVDHWLKNVFSESNKQLGVMYLTGPAGSGKSTTVEVMCTEQNIEIIEYSP 79

  Fly    72 QQFKSMVLELNASDD--------RGIGIVRGQILNFASTRTIFCDTFKLIILDE-ADAMTNDAQ- 126
            :...:...|....|.        |..|.:||..|.           .:|:::.| .|...:||: 
 Worm    80 EYLHNEDFECEKPDFTQLRRFLLRRHGSLRGGGLK-----------KRLLLVTELPDQAYSDAEK 133

  Fly   127 --NALRRIIEKYTDNVRFC----VICNYLS---------KIIPALQSRCTRFRFAPLSQDQMMPR 176
              ..|..:::.....|.||    :.|..|:         .|:..:.:    ..|.|::...|...
 Worm   134 FREDLSEVLQHIWHPVIFCLTNSIACWNLNPDRLFTKDFNIMNGIDT----VTFNPVADSFMKKA 194

  Fly   177 LEKIIEAEAVQITEDGKRALLTLAKGDMRKVLNVLQSTVMAFDTVNED----NVYMCVGYPLRQD 237
            |.:.....:..:::.....:...|.||:|..:|:||...:.   .|.|    |..:|.....|::
 Worm   195 LVRASNCLSSPLSDAKLNVIGEEAGGDLRIAMNMLQMNSIG---PNADRRSGNSVICASKANREE 256

  Fly   238 IEQILKALLSGSSLEDSF-KTVESAKYARGLA----------LE----DIITELHLFVMRLELPM 287
            ...::..:|....:..:. |....:|..|..|          ||    ||||            |
 Worm   257 AFHMIGRILYAKRVNPNVPKPSRFSKRRRKSAPIPEPLVRTELEHDPTDIIT------------M 309

  Fly   288 SVM--NKLIVKLAQIEERLAKGCTEVAQTAALVAAFFIC 324
            |.|  .||:..|.|.|...   |:.:::...:...|.:|
 Worm   310 SSMTSEKLLDFLFQNEPIF---CSNISKYRYVAETFSMC 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RfC3NP_609399.1 rfc 12..321 CDD:234763 75/359 (21%)
hpr-17NP_496793.1 Rad17 15..375 CDD:251803 77/364 (21%)
AAA_16 28..153 CDD:289934 31/135 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0470
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.