DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Klp31E and si:cabz01066312.1

DIOPT Version :9

Sequence 1:NP_001162935.1 Gene:Klp31E / 34422 FlyBaseID:FBgn0032243 Length:1048 Species:Drosophila melanogaster
Sequence 2:XP_003198627.2 Gene:si:cabz01066312.1 / 100537698 ZFINID:ZDB-GENE-161017-136 Length:488 Species:Danio rerio


Alignment Length:190 Identity:39/190 - (20%)
Similarity:73/190 - (38%) Gaps:56/190 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   485 LIESEEHRKQMEIKATTSPRNA--KPVYDSDIITKAKKDLERERELL------------------ 529
            ::||.|..|::    |.:|.:.  :||...:.::.|:.....||:.|                  
Zfish    82 VVESPEGNKEL----TPAPYSGDREPVTKINAVSSARSPTATERKSLDRSPLTRRRMQERSQNHT 142

  Fly   530 -MSRSL--PGIQNQNVSSEETEVASSD--SEAEEVVKDLEAIDNDIEM-------RTKLIEQLEL 582
             .||:|  ||:.:..:::..:..|...  ..||...|.|..:|:..::       ||..:..| :
Zfish   143 DRSRTLDKPGVASPALAARSSRAARLQCVHVAEGHTKPLLCLDSTDDLLFTGSKDRTCKVWNL-V 206

  Fly   583 TNSRYEQMRTHYEEKLSVLYCKIENTQKERDDVLANMTTSVST------PSKDSLKKVKT 636
            |......:..|....:||.||             :::..:|||      ..:||.|.::|
Zfish   207 TGQEIMSLGDHPSSVVSVRYC-------------SSLVFTVSTAYVKVWDIRDSAKCIRT 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Klp31ENP_001162935.1 KISc_KIF4 12..364 CDD:276823
KISc 13..370 CDD:214526
KASH_CCD 409..589 CDD:291334 27/135 (20%)
RasGAP <685..750 CDD:295371
si:cabz01066312.1XP_003198627.2 WD40 170..478 CDD:238121 21/98 (21%)
WD40 176..>480 CDD:225201 19/92 (21%)
WD40 repeat 222..256 CDD:293791 11/45 (24%)
WD40 repeat 280..319 CDD:293791
WD40 repeat 324..360 CDD:293791
WD40 repeat 367..407 CDD:293791
WD40 repeat 413..446 CDD:293791
WD40 repeat 455..477 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D74122at33208
OrthoFinder 1 1.000 - - FOG0002395
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.