powered by:
Protein Alignment RpS27A and RAD23
DIOPT Version :9
Sequence 1: | NP_476778.1 |
Gene: | RpS27A / 34420 |
FlyBaseID: | FBgn0003942 |
Length: | 156 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_010877.3 |
Gene: | RAD23 / 856674 |
SGDID: | S000000763 |
Length: | 398 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 72 |
Identity: | 22/72 - (30%) |
Similarity: | 37/72 - (51%) |
Gaps: | 11/72 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNI--------- 61
|....:.:.|::|||:||...|.|:.........|.:||::||.|:|.:|:|:..:
Yeast 7 KNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFM 71
Fly 62 --QKEST 66
||:||
Yeast 72 VSQKKST 78
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG5272 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.