DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and RAD23A

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_173070.1 Gene:RAD23A / 838188 AraportID:AT1G16190 Length:368 Species:Arabidopsis thaliana


Alignment Length:74 Identity:30/74 - (40%)
Similarity:42/74 - (56%) Gaps:3/74 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQD---KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62
            |::.||||.|....:.|.|:|||..||..|:|   |:..|..||.||..||.|:|..||.:..:.
plant     1 MKLTVKTLKGSHFEIRVLPTDTIMAVKKNIEDSQSKDNYPCGQQLLIHNGKVLKDETTLVENKVT 65

  Fly    63 KESTLHLVL 71
            :|..|.::|
plant    66 EEGFLVVML 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 30/74 (41%)
Ribosomal_S27 103..147 CDD:460261
RAD23ANP_173070.1 rad23 1..365 CDD:273167 30/74 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.