Sequence 1: | NP_476778.1 | Gene: | RpS27A / 34420 | FlyBaseID: | FBgn0003942 | Length: | 156 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001318634.1 | Gene: | AT5G24240 / 832491 | AraportID: | AT5G24240 | Length: | 574 | Species: | Arabidopsis thaliana |
Alignment Length: | 196 | Identity: | 48/196 - (24%) |
---|---|---|---|
Similarity: | 71/196 - (36%) | Gaps: | 57/196 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKE---GIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64
Fly 65 STLHLVLRLRGGAKKRKK------------------------KNYSTPKKIKH-------KRKKV 98
Fly 99 KLAVLKYYKVDE--------NGKIHRLRRECPGENCGAGVFMAAHEDRHYCGKCNLTFVFSKPEE 155
Fly 156 K 156 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RpS27A | NP_476778.1 | Ubl_ubiquitin | 1..76 | CDD:340501 | 26/75 (35%) |
Ribosomal_S27 | 103..147 | CDD:396259 | 8/51 (16%) | ||
AT5G24240 | NP_001318634.1 | Ubiquitin_like_fold | 34..105 | CDD:421700 | |
Ubl_ubiquitin_like | 111..180 | CDD:340559 | 25/69 (36%) | ||
PI3_PI4_kinase | 266..521 | CDD:395364 | 7/32 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5272 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |