DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and AT5G24240

DIOPT Version :9

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001318634.1 Gene:AT5G24240 / 832491 AraportID:AT5G24240 Length:574 Species:Arabidopsis thaliana


Alignment Length:196 Identity:48/196 - (24%)
Similarity:71/196 - (36%) Gaps:57/196 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKE---GIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64
            |.|:|:.||...|.||.|..:..||.:|..||   |||.|.: |...|::|:|.|.::|.....:
plant   111 ISVRTVDGKEFELVVERSRNVGYVKQQIASKEKELGIPRDHE-LTLDGEELDDQRLITDLCQNGD 174

  Fly    65 STLHLVLRLRGGAKKRKK------------------------KNYSTPKKIKH-------KRKKV 98
            :.:||:  :...||.|.|                        ||.|:..|.|.       ...::
plant   175 NVIHLL--ISKSAKVRAKPVGKDFEVFIEDVNHKHNVDGRRGKNISSEAKPKEFFVEPFIVNPEI 237

  Fly    99 KLAVLKYYKVDE--------NGKIHRLRRECPGENCGAGVFMAAHEDRHYCGKCNLTFVFSKPEE 155
            ||.:|....:..        ||.|.      ..:..|...||.......|..      ||...:|
plant   238 KLPILLKELISSTLEGLEKGNGPIR------SSDGSGGAYFMQDPSGHKYVS------VFKPIDE 290

  Fly   156 K 156
            :
plant   291 E 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 26/75 (35%)
Ribosomal_S27 103..147 CDD:396259 8/51 (16%)
AT5G24240NP_001318634.1 Ubiquitin_like_fold 34..105 CDD:421700
Ubl_ubiquitin_like 111..180 CDD:340559 25/69 (36%)
PI3_PI4_kinase 266..521 CDD:395364 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.