DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and Ubqln5

DIOPT Version :9

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_081910.1 Gene:Ubqln5 / 70980 MGIID:1918230 Length:510 Species:Mus musculus


Alignment Length:84 Identity:29/84 - (34%)
Similarity:35/84 - (41%) Gaps:24/84 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EPSDTIENVKAKI-QD---------------KEGIP------PDQQRLIFAGKQLEDGRTLSDYN 60
            |||..|..|..|. ||               |:.|.      .|:..|||.||.|.|...||...
Mouse    18 EPSSRIIRVSVKTPQDCHEFFLAENSNVRRFKKQISKYLHCNADRLVLIFTGKILRDQDILSQRG 82

  Fly    61 IQKESTLHLVLR--LRGGA 77
            |...||:|:|:|  |:|.|
Mouse    83 ILDGSTVHVVVRSHLKGSA 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 27/81 (33%)
Ribosomal_S27 103..147 CDD:396259
Ubqln5NP_081910.1 UBQ 24..94 CDD:214563 21/69 (30%)
UBQ 24..94 CDD:294102 21/69 (30%)
UBA_PLICs 467..506 CDD:270582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.