DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS27A and RAD23B

DIOPT Version :10

Sequence 1:NP_476778.1 Gene:RpS27A / 34420 FlyBaseID:FBgn0003942 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_002865.1 Gene:RAD23B / 5887 HGNCID:9813 Length:409 Species:Homo sapiens


Alignment Length:91 Identity:29/91 - (31%)
Similarity:53/91 - (58%) Gaps:11/91 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPDQQRLIFAGKQLEDGRTLSDYNIQ 62
            ||:.:|||..:|..::::|.:|::.:|.||:.::|   .|...|:||:|||.|.|...|.:|.|.
Human     1 MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKID 65

  Fly    63 KESTLHLVLRLRGGAKKRKKKNYSTP 88
            :::.:.:::        .|.|..|||
Human    66 EKNFVVVMV--------TKPKAVSTP 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS27ANP_476778.1 Ubl_ubiquitin 1..76 CDD:340501 24/77 (31%)
Ribosomal_S27 103..147 CDD:460261
RAD23BNP_002865.1 rad23 1..407 CDD:273167 29/91 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..175 3/4 (75%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 236..276
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.